KEGG   Escherichia coli K-12 MG1655: b4067Help
Entry
b4067             CDS       T00007                                 

Gene name
actP
Definition
(RefSeq) acetate transporter
  KO
K14393  
cation/acetate symporter
Organism
eco  Escherichia coli K-12 MG1655
Brite
Transporters [BR:eco02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   b4067 (actP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
complement(4283253..4284902)
Genome map
AA seq 549 aa AA seqDB search
MKRVLTALAATLPFAANAADAISGAVERQPTNWQAIIMFLIFVVFTLGITYWASKRVRSR
SDYYTAGGNITGFQNGLAIAGDYMSAASFLGISALVFTSGYDGLIYSLGFLVGWPIILFL
IAERLRNLGRYTFADVASYRLKQGPIRILSACGSLVVVALYLIAQMVGAGKLIELLFGLN
YHIAVVLVGVLMMMYVLFGGMLATTWVQIIKAVLLLFGASFMAFMVMKHVGFSFNNLFSE
AMAVHPKGVDIMKPGGLVKDPISALSLGLGLMFGTAGLPHILMRFFTVSDAREARKSVFY
ATGFMGYFYILTFIIGFGAIMLVGANPEYKDAAGHLIGGNNMAAVHLANAVGGNLFLGFI
SAVAFATILAVVAGLTLAGASAVSHDLYANVFKKGATEREELRVSKITVLILGVIAIILG
VLFENQNIAFMVGLAFAIAASCNFPIILLSMYWSKLTTRGAMMGGWLGLITAVVLMILGP
TIWVQILGHEKAIFPYEYPALFSITVAFLGIWFFSATDNSAEGARERELFRAQFIRSQTG
FGVEQGRAH
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagagttctgacggcgcttgccgccacactccctttcgcagctaacgccgcggat
gctattagcggggccgtagagcgccagccaacgaactggcaggcgattattatgttcctg
attttcgtcgtgtttacgctcggcattacctactgggcatcaaaacgcgtacgttctcgt
agcgactactacaccgcaggcggcaatatcactggcttccagaacgggctggcgattgcc
ggggactatatgtccgccgcctcattcttggggatctccgcgctggtgtttacctccggc
tatgacggcttaatttactcgctgggcttcctggtgggctggccgatcattttgttcctg
attgccgaacgtctgcgtaacctggggcgctacacctttgccgatgtggcctcttaccgt
ctgaaacaagggccgattcgtattctttcggcctgtggttctctggtggtggtggcgctt
taccttatcgcccagatggtgggcgcaggtaaactgatcgagctgctgtttggccttaac
tatcacattgcggtggtgctggtcggcgtgctgatgatgatgtacgtcctgttcggcggc
atgctggcgaccacctgggtgcaaattatcaaagccgtgctgttgctgttcggtgccagc
tttatggcctttatggtgatgaaacacgtcggctttagcttcaacaatctgttcagtgaa
gcgatggcggtacacccgaaaggtgtcgacatcatgaagccgggcgggctggtgaaagat
ccgatctccgcgctctctctgggtctgggactgatgtttggtacggcgggcttgccgcac
attctgatgcgcttctttacagtcagcgatgcccgcgaagcacgtaagagcgtgttctac
gccaccgggtttatgggctacttctatattctgacctttattatcggcttcggcgcgatc
atgctggttggtgcgaatccggaatataaagacgcggcgggccatctgattggtggtaac
aacatggcggccgttcacctggcgaatgcagtgggcggcaacctgttcctcggttttatt
tcagcggttgctttcgccactatcctcgcggtggttgcgggtctgacgctggcgggcgca
tccgcggtttcgcatgacttgtacgctaacgtcttcaaaaaaggcgcgaccgaacgtgaa
gagctgcgggtatcaaaaatcaccgtactgatcctcggcgtgattgcgattatcctcggc
gtgctgtttgagaatcagaacatcgcctttatggtggggctggcgtttgccatcgcggcg
agctgtaacttcccgatcattctgctttctatgtactggtcgaaactgaccacgcgtggc
gcgatgatgggtggctggctggggctgattaccgcagtagtactgatgatcctcggcccg
acgatttgggtacagatccttggtcacgaaaaagccatcttcccgtatgaatacccggcg
ctgttctctatcaccgtggcattcctcggcatctggttcttctcggcaaccgataactca
gcggaaggcgcgcgtgagcgtgaactgttccgcgcgcagtttatccgctcccagaccggc
tttggcgttgagcaaggccgcgcgcattaa

DBGET integrated database retrieval system