KEGG   Escherichia coli O81 ED1a (commensal): ECED1_0396Help
Entry
ECED1_0396        CDS       T00827                                 

Gene name
hemB
Definition
(GenBank) porphobilinogen synthase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
ecq  Escherichia coli O81 ED1a (commensal)
Pathway
ecq00860  Porphyrin and chlorophyll metabolism
ecq01100  Metabolic pathways
ecq01110  Biosynthesis of secondary metabolites
ecq01120  Microbial metabolism in diverse environments
Module
ecq_M00121  Heme biosynthesis, glutamate => heme
ecq_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:ecq00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    ECED1_0396 (hemB)
Enzymes [BR:ecq01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     ECED1_0396 (hemB)
Exosome [BR:ecq04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ECED1_0396 (hemB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD ComA
Motif
Other DBs
NCBI-ProteinID: CAR06606
UniProt: B7MPD4
Structure
PDB: 

Jmol
Position
complement(414071..415045)
Genome map
AA seq 324 aa AA seqDB search
MTDLIQRPRRLRKSPALRAMFEETTLSLNDLVLPIFVEEEIDDYKAVEAMPGVMRIPEKH
LAREIERIANAGIRSVMTFGISHHTDETGSDAWREDGLVARMSRICKQTVPEMIVMSDTC
FCEYTSHGHCGVLCEHGVDNDATLENLGKQAVVAAAAGADFIAPSAAMDGQVQAIRQALD
AAGFKDTAIMSYSTKFASSFYGPFREAAGSALKGDRKSYQMNPMNRREAIRESLLDEAQG
ADCLMVKPAGAYLDIVRELRERTELPIGAYQVSGEYAMIKFAVLAGAIDEEKVVLESLGS
IKRAGADLIFSYFALDLAEKKILR
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgacagatttaatccaacgccctcgtcgcctgcgcaaatctcctgcgctgcgcgctatg
tttgaagagacaacacttagccttaacgacctggtgttgccgatctttgttgaagaagaa
attgacgactacaaagccgttgaagccatgccaggcgtgatgcgcattccagagaaacat
ctggcacgcgaaattgaacgcatcgccaacgccggtattcgttccgtgatgactttcggc
atctctcaccataccgatgaaaccggcagcgatgcctggcgggaagatggactggtggcg
cgtatgtcgcgcatctgcaagcagaccgtgccagaaatgatcgttatgtcagacacctgc
ttctgtgaatacacatctcacggtcactgcggtgttctgtgcgagcatggcgtcgacaac
gacgcgactctggaaaatttaggcaagcaagctgtggttgcagctgctgcaggcgcagac
ttcatcgccccttctgccgcgatggatggtcaggtacaggcgattcgccaggcgctggac
gctgcgggctttaaagatacggcgattatgtcgtattcgaccaagttcgcctcctccttt
tatggcccgttccgtgaagctgccggaagcgcattaaaaggcgaccgcaaaagctatcag
atgaacccaatgaaccgtcgtgaggcgattcgtgagtcgctgctggatgaagcccagggc
gcagactgcctgatggttaaacctgccggagcatacctcgacatcgtgcgtgagctgcgt
gaacgtactgaattgccgattggcgcgtatcaggtgagcggtgagtacgcgatgattaag
ttcgccgtgctggcgggtgctatagatgaagagaaagtcgtgctcgaaagcttaggttcg
attaaacgtgcgggtgcggatctgattttcagctactttgcgctggatttggctgagaag
aagattctgcgttaa

DBGET integrated database retrieval system