KEGG   Encephalitozoon cuniculi: ECU08_0900Help
Entry
ECU08_0900        CDS       T00105                                 

Definition
EUKARYOTIC TRANSLATION INITIATION FACTOR 4E (mRNA CAP-BINDING PROTEIN)
Orthology
K03259  
translation initiation factor 4E
Organism
ecu  Encephalitozoon cuniculi
Pathway
RNA transport
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:ecu00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    ECU08_0900
Translation factors [BR:ecu03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    ECU08_0900
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
VIII:104154..104675
Genome map
AA seq 173 aa AA seqDB search
MELASQWVFWQNSNDESNAKSWGDDLVAVGEVSTVPEFLYLCDEISNAGIGRLCTMNLFR
KGIKPMWEDEANIDGGRIIMDVPVSGKDNVGELWKRTMAFCVSNTVDNICGCVFNEKQSF
YKIAIWFGKDYNQDVIKDMWQEALGPGRLSIYSFLHKKSLDSSKGKKKWGGRR
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atggagttggcatcgcaatgggttttctggcaaaacagcaacgacgagtcgaatgccaaa
agctggggggacgatcttgtggcggttggagaggtgtcaacggttcccgagttcctgtat
ctctgtgacgagatatcgaatgcggggattggtaggctgtgcacgatgaatttgttcaga
aagggaatcaagccgatgtgggaggacgaagcgaatatagacggaggaaggattataatg
gacgtccccgtttctgggaaggacaatgttggtgagctgtggaagaggacaatggcattt
tgcgtgtcgaacactgtcgacaacatatgcggatgtgtgttcaacgagaagcagtcattc
tataagatagccatttggtttgggaaggattataaccaggatgtcatcaaagacatgtgg
caggaggcccttgggcctggaaggctatccatctactcgtttctacacaagaagtcattg
gacagcagcaagggaaagaagaagtggggaggcagaagataa

DBGET integrated database retrieval system