KEGG   Entamoeba dispar: EDI_004720Help
Entry
EDI_004720        CDS       T01083                                 

Definition
(RefSeq) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
edi  Entamoeba dispar
Pathway
edi00010  Glycolysis / Gluconeogenesis
edi00030  Pentose phosphate pathway
edi00051  Fructose and mannose metabolism
edi00052  Galactose metabolism
edi01100  Metabolic pathways
edi01110  Biosynthesis of secondary metabolites
edi01130  Biosynthesis of antibiotics
edi01200  Carbon metabolism
edi01230  Biosynthesis of amino acids
edi03018  RNA degradation
Module
edi_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:edi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EDI_004720
   00030 Pentose phosphate pathway
    EDI_004720
   00051 Fructose and mannose metabolism
    EDI_004720
   00052 Galactose metabolism
    EDI_004720
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    EDI_004720
Enzymes [BR:edi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     EDI_004720
Protein phosphatases and associated proteins [BR:edi01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     EDI_004720
Messenger RNA biogenesis [BR:edi03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     EDI_004720
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK NAD_kinase DAGK_cat
Motif
Other DBs
NCBI-GeneID: 5879754
NCBI-ProteinID: XP_001734830
UniProt: B0E8Z7
AA seq 439 aa AA seqDB search
MSERRHVHQRNDLLIAKKPEEPLPSLEVSSLGECKYKNTYASPEPFVDGMTMSMSAIKID
GIPVNECEAELAGPMEKIFFIPERTKVGIVTCGGLCPGLNNVIRGLVMNLQNRYGVKQIY
GLKYGYEGLVPELSEQMKLDTSVVDDIHQRGGTILGTSRGAQDPKVMAQFLIDNNFNILF
TLGGDGTLRGANRINKELRRRGSPIVVVGIPKTIDNDICYTDSTFGFDTAVELAQEAINS
VHYEAKSAKNGIGIVKLMGRDAGFIALYASVASGDVNLVLIPEVDTPIEEILRMTERRLM
SKGHIVIVIAEGACQNLKPKDLDLGSDKSGNIVHWDAVTYIRQEIDKYLENKKIEHTIKF
VDPSYMIRSAPCSAADAHFCLCLANAAVHVAMAGKTGLVICHHHNNFVSIPIERACYYLK
RVNPEGPLLSMMKSIESVE
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaaagaagacacgttcatcaaagaaatgatttacttattgctaaaaaacctgaa
gaaccacttccatcattagaagtttcatcattaggagaatgtaaatataaaaatacatat
gcatcacctgaaccttttgtagatggaatgacaatgtctatgtctgctattaaaattgat
ggaatacctgttaatgagtgtgaggctgagttagcaggaccaatggaaaaaatattcttt
attccagaaagaaccaaagttggaatagtaacatgtggaggattgtgtccaggattaaat
aatgttattagaggcttagttatgaaccttcaaaatagatatggggttaaacaaatttat
ggtttaaaatatggttatgaaggacttgttcctgaattatctgaacaaatgaaacttgac
acatctgttgtcgatgatattcatcaaagaggtggaactattttaggtacttcaagagga
gctcaagaccctaaagttatggcacaatttcttattgacaataattttaatattcttttc
acattaggaggagatggtacattaaggggtgctaatagaattaataaagaattaagaaga
agaggtagtcctattgtagttgttggtattcctaaaactattgataatgatatttgttat
acagattctacttttggatttgatactgctgtagaattagcacaagaagcaattaattca
gttcattatgaagctaaatcagcaaagaatggaattggaatagttaaattaatgggtaga
gatgcaggatttattgcattatatgcatctgttgcatcaggagatgtaaatttagtatta
attccagaagttgatactccaattgaagagattcttagaatgacagaaagaagattaatg
tcaaaaggacatatagtaattgttattgctgaaggagcatgtcaaaaccttaaaccaaaa
gatcttgatcttggtagtgataagtcaggaaatattgttcattgggatgctgttacgtat
attagacaagaaatagacaaatatttagagaataaaaaaatagaacataccattaaattt
gttgatccatcttatatgattcgttctgcgccttgtagtgctgctgatgcacatttctgt
ttatgtttagctaatgcagcagttcatgttgctatggcaggaaaaacaggattagttatt
tgtcatcaccataataactttgtttcaataccaattgaaagggcatgttattatttaaaa
agagtaaatcctgaagggccattattatcaatgatgaagtccattgagtctgttgaatga

DBGET integrated database retrieval system