KEGG   Eubacterium eligens: EUBELI_01301Help
Entry
EUBELI_01301      CDS       T00908                                 

Definition
(GenBank) tryptophan synthase
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
eel  Eubacterium eligens
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:eel00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    EUBELI_01301
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    EUBELI_01301
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    EUBELI_01301
Enzymes [BR:eel01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     EUBELI_01301
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1338629..1339423)
Genome map
AA seq 264 aa AA seqDB search
MNRIEERLAALKEEGKKAFITYTTAGLPDYDTTKKIMFAQEKAGIDIMEIGVPFSDPIAD
GPVIQDASFKAIQNGASLEGIFTMMGKVRKAGLNSPVVFMLYYNTVYHYGVENFVNKCIE
NGVDGLIIPDLPFEEQGEIKDVLAKNEKSPILIQLVSPVSKGRIPMLLENARGFVYCVSQ
MGVTGKGANFHSQIREYLTEVKKESKIPVMMGFGIRTAADVAPLEDIIDGAIVGSHFIKL
LEANNYSEEAATDYVATFKKELNA
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgaatagaatagaagaaagacttgcagcacttaaagaagagggaaagaaagcatttatt
acatatacaacagcaggacttccagattacgatacaactaagaagattatgtttgcacag
gagaaggcaggaatcgatattatggaaataggtgttcctttctcagatcctattgcagat
ggccctgtaattcaggatgcatctttcaaagcaatacagaatggagcttcacttgaaggc
atatttacaatgatgggtaaggtaagaaaagctggtcttaacagccctgttgtattcatg
ctttactataatactgtatatcattatggagttgagaacttcgtgaataaatgtattgaa
aatggtgttgacggacttatcatacctgaccttccattcgaggagcagggcgagattaag
gatgtccttgcaaagaacgagaagtcgccaattcttatccagcttgtatctccggtatct
aagggcaggattccaatgcttttagagaacgcaagaggttttgtatactgcgtttcacag
atgggtgttacaggaaagggagctaacttccattcacagataagagaatatcttacagaa
gttaagaaagaatctaagattcctgttatgatgggattcggaataagaacagcagcagat
gttgcaccgcttgaagatattattgatggtgcaatcgttggttcacattttatcaagctt
cttgaagctaataattattcagaggaagctgccacagattatgttgcaacatttaagaag
gagcttaatgcctga

DBGET integrated database retrieval system