KEGG   Eubacterium eligens: EUBELI_01301Help
Entry
EUBELI_01301      CDS       T00908                                 

Definition
tryptophan synthase
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
eel  Eubacterium eligens
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:eel00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    EUBELI_01301
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    EUBELI_01301
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    EUBELI_01301
Enzymes [BR:eel01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     EUBELI_01301
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1338629..1339423)
Genome map
AA seq 264 aa AA seqDB search
MNRIEERLAALKEEGKKAFITYTTAGLPDYDTTKKIMFAQEKAGIDIMEIGVPFSDPIAD
GPVIQDASFKAIQNGASLEGIFTMMGKVRKAGLNSPVVFMLYYNTVYHYGVENFVNKCIE
NGVDGLIIPDLPFEEQGEIKDVLAKNEKSPILIQLVSPVSKGRIPMLLENARGFVYCVSQ
MGVTGKGANFHSQIREYLTEVKKESKIPVMMGFGIRTAADVAPLEDIIDGAIVGSHFIKL
LEANNYSEEAATDYVATFKKELNA
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgaatagaatagaagaaagacttgcagcacttaaagaagagggaaagaaagcatttatt
acatatacaacagcaggacttccagattacgatacaactaagaagattatgtttgcacag
gagaaggcaggaatcgatattatggaaataggtgttcctttctcagatcctattgcagat
ggccctgtaattcaggatgcatctttcaaagcaatacagaatggagcttcacttgaaggc
atatttacaatgatgggtaaggtaagaaaagctggtcttaacagccctgttgtattcatg
ctttactataatactgtatatcattatggagttgagaacttcgtgaataaatgtattgaa
aatggtgttgacggacttatcatacctgaccttccattcgaggagcagggcgagattaag
gatgtccttgcaaagaacgagaagtcgccaattcttatccagcttgtatctccggtatct
aagggcaggattccaatgcttttagagaacgcaagaggttttgtatactgcgtttcacag
atgggtgttacaggaaagggagctaacttccattcacagataagagaatatcttacagaa
gttaagaaagaatctaagattcctgttatgatgggattcggaataagaacagcagcagat
gttgcaccgcttgaagatattattgatggtgcaatcgttggttcacattttatcaagctt
cttgaagctaataattattcagaggaagctgccacagattatgttgcaacatttaagaag
gagcttaatgcctga

DBGET integrated database retrieval system