KEGG   Enterococcus faecalis D32: EFD32_0106Help
Entry
EFD32_0106        CDS       T02172                                 

Definition
glycosyl hydrolase family 20, catalytic domain protein
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
efd  Enterococcus faecalis D32
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:efd00520]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:efd00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
121741..124248
Genome map
AA seq 835 aa AA seqDB search
MNGVQKGMVFKVGNNLSTRKGENRETIVSWLGLSLLVGLAFILFSLFHQPMISQANEPTQ
EKHFMVYYRAWRDKTMQGVNTTLPDENWLTMHDIPYGIDIVNVFSYVPKGQEALAQPFYD
TLKNEYAPALHARGVRLVRGIDYSELLKVPYAGTTPTEAEFDAYAKELLTKFVDDLGIDG
LDIDMETRPSEKDIVLSNGVIRALSKYIGPKSGTDRPFLYDTNAEYLPPLQDVSDCFDFL
AYQQYGSDDQRTQRALNNLSPVLNGERFVPGLTFPEEQDRNRWYDTKEPYMESNMYKVAR
YSYENNLGGMFLYALDRDGRTYNEDDLNQIKPSNLLWTKTAIAESKGVSLAEMKAAAQHY
LKRISYANTDLEAQNKAAEAVTQATTLYDVNKAILGGDYGQGISNTYDAELEKGLLAIDL
TTLYRALDQAVTAIEKAESYTPETIQALQTTKETVATELAGKTYTAAQVTTWQTEVQTAL
DNLKEKQTQPLKSVFSIDAGRKYFSVEQLEELVAKASQNGYTDVQLILGNDGLRFILDDM
SVNVNGKKYNHNRVSKAIQRGNNAYYNDPNGNALTQKEMDRLLAFAKARNINIIPVINSP
GHMDALLVAMEKLAIKNPAFDGSKRTVDLGNQKAVNFTKAIISKYVAYFSAHSEIFNFGG
DEYANDVDTGGWAKLQSSGRYKDFVAYANDLAKIIKDAGMQPMSFNDGIYYNSDDSFGTF
DPEIIISYWTAGWSGYDVAKPEYFVQKGHKIFNTNDAWYWVAGNVDSGIYQYDDALANMS
KKAFTDVPAGSPNLPIIGSIQCVWYDDPRRDYDFERIYTLMDTFSENYREYMVVK
NT seq 2508 nt NT seq  +upstreamnt  +downstreamnt
atgaacggagtgcagaaaggaatggtgttcaaagtggggaacaatttatcgacaagaaaa
ggagaaaacagagaaacaattgtcagttggctgggtctttcgttattggttggcttggcg
tttatcttatttagtctgtttcatcaaccaatgatcagccaagccaatgagccgacccaa
gagaaacattttatggtttattatcgggcctggcgtgacaaaacgatgcaaggagttaat
acaacattgccagatgaaaattggctaacgatgcacgatattccttatggtattgacatt
gtgaatgtctttagttatgtgccaaaaggacaagaagcacttgcacagccattttatgat
acgttaaaaaatgagtatgcgccagcactgcatgcacgaggtgttcgtttagttcgtggg
attgattacagcgagctattaaaagttccttacgcaggaacaacgcctacagaagcagaa
tttgatgcttatgcgaaagagttgttaaccaaatttgtcgatgatttaggaattgatggg
ttagatattgacatggaaactcgtccaagtgaaaaagatattgttctatctaatggtgtc
attcgtgcattatcaaaatacattggaccgaagtcgggaacggatcgtccatttttgtat
gataccaatgcagaatatttaccacctttacaagatgtcagtgactgtttcgattttctc
gcgtatcaacagtatggtagcgatgaccaacgcacgcaacgagcattaaataatttaagt
ccggttctcaatggggaacgatttgttccaggattaactttcccagaagagcaagatcgc
aaccgctggtatgacacaaaagagccgtatatggaaagtaacatgtataaagtagctcgt
tattcttatgaaaataatttagggggcatgttcctctatgccttagatcgcgatggtcgc
acctataatgaagacgatttaaatcagataaaaccttctaatttactttggacaaaaacg
gccattgcagagagtaaaggcgtttctcttgcagagatgaaagcggctgcgcaacactat
ttaaaacgaattagctacgccaacacagaccttgaagcacaaaataaagccgcagaagca
gtgacacaagcaacgacgctttatgatgtgaataaagctattttaggtggcgattatggc
caagggatttcaaatacctatgatgctgaattagaaaaaggcctgttagccattgactta
accactttatatcgtgcgttggatcaagcagttacagccattgaaaaggcagaaagctat
acaccagaaacgattcaagcactacaaacaacaaaagagacagtcgcaacagaacttgcg
ggaaaaacgtatacagccgcgcaagtgactacttggcaaacggaggtccaaacagctttg
gataatttaaaagagaaacaaacacaacctttaaaaagtgtcttctccattgatgcggga
agaaaatatttttccgtggagcaactggaagaattagtggccaaagccagtcaaaatggg
tacacagatgtccaattaattttaggaaatgatggcttacggtttatcttggatgatatg
tcggtcaatgtgaatggtaaaaaatacaaccacaaccgggtttcaaaagcaatccaacga
ggcaacaacgcgtattacaatgatcctaatggcaacgcgttaacacaaaaagaaatggat
cggttgttggcttttgcgaaagcgcgcaacatcaacatcattcccgtgattaacagtcca
ggacatatggatgccttgttagtggccatggaaaaactagcgattaaaaatcccgctttt
gatggctcaaaacgaacagtagatttagggaaccaaaaggcagtgaatttcacaaaggcg
attatcagtaagtacgtggcttatttttccgcgcatagtgaaattttcaattttggtggc
gatgagtatgcaaatgatgtcgacacaggcggttgggcgaaactgcaatcttctgggcgc
tacaaggattttgtcgcttatgcgaatgatttagctaaaataattaaagatgcgggcatg
cagccaatgagcttcaatgatggcatttattacaacagcgacgattctttcggtacattt
gacccagagattattatttcttattggacagccggttggagtgggtatgacgtagccaaa
cctgagtactttgttcaaaaaggacacaaaatttttaataccaatgatgcgtggtattgg
gtagctggcaatgttgattctggcatttatcaatatgacgatgctttagcaaatatgtcg
aaaaaagcatttacagatgtgccagcaggtagcccgaatcttccaattattggaagtatt
caatgtgtttggtatgatgaccctcgtcgtgactatgattttgaacgaatttatacgcta
atggatacgttctcggaaaattatcgtgagtatatggtggttaaataa

DBGET integrated database retrieval system