KEGG   Enterococcus faecalis D32: EFD32_0106Help
Entry
EFD32_0106        CDS       T02172                                 

Definition
glycosyl hydrolase family 20, catalytic domain protein
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
efd  Enterococcus faecalis D32
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:efd00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    EFD32_0106
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    EFD32_0106
Enzymes [BR:efd01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     EFD32_0106
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
121741..124248
Genome map
AA seq 835 aa AA seqDB search
MNGVQKGMVFKVGNNLSTRKGENRETIVSWLGLSLLVGLAFILFSLFHQPMISQANEPTQ
EKHFMVYYRAWRDKTMQGVNTTLPDENWLTMHDIPYGIDIVNVFSYVPKGQEALAQPFYD
TLKNEYAPALHARGVRLVRGIDYSELLKVPYAGTTPTEAEFDAYAKELLTKFVDDLGIDG
LDIDMETRPSEKDIVLSNGVIRALSKYIGPKSGTDRPFLYDTNAEYLPPLQDVSDCFDFL
AYQQYGSDDQRTQRALNNLSPVLNGERFVPGLTFPEEQDRNRWYDTKEPYMESNMYKVAR
YSYENNLGGMFLYALDRDGRTYNEDDLNQIKPSNLLWTKTAIAESKGVSLAEMKAAAQHY
LKRISYANTDLEAQNKAAEAVTQATTLYDVNKAILGGDYGQGISNTYDAELEKGLLAIDL
TTLYRALDQAVTAIEKAESYTPETIQALQTTKETVATELAGKTYTAAQVTTWQTEVQTAL
DNLKEKQTQPLKSVFSIDAGRKYFSVEQLEELVAKASQNGYTDVQLILGNDGLRFILDDM
SVNVNGKKYNHNRVSKAIQRGNNAYYNDPNGNALTQKEMDRLLAFAKARNINIIPVINSP
GHMDALLVAMEKLAIKNPAFDGSKRTVDLGNQKAVNFTKAIISKYVAYFSAHSEIFNFGG
DEYANDVDTGGWAKLQSSGRYKDFVAYANDLAKIIKDAGMQPMSFNDGIYYNSDDSFGTF
DPEIIISYWTAGWSGYDVAKPEYFVQKGHKIFNTNDAWYWVAGNVDSGIYQYDDALANMS
KKAFTDVPAGSPNLPIIGSIQCVWYDDPRRDYDFERIYTLMDTFSENYREYMVVK
NT seq 2508 nt NT seq  +upstreamnt  +downstreamnt
atgaacggagtgcagaaaggaatggtgttcaaagtggggaacaatttatcgacaagaaaa
ggagaaaacagagaaacaattgtcagttggctgggtctttcgttattggttggcttggcg
tttatcttatttagtctgtttcatcaaccaatgatcagccaagccaatgagccgacccaa
gagaaacattttatggtttattatcgggcctggcgtgacaaaacgatgcaaggagttaat
acaacattgccagatgaaaattggctaacgatgcacgatattccttatggtattgacatt
gtgaatgtctttagttatgtgccaaaaggacaagaagcacttgcacagccattttatgat
acgttaaaaaatgagtatgcgccagcactgcatgcacgaggtgttcgtttagttcgtggg
attgattacagcgagctattaaaagttccttacgcaggaacaacgcctacagaagcagaa
tttgatgcttatgcgaaagagttgttaaccaaatttgtcgatgatttaggaattgatggg
ttagatattgacatggaaactcgtccaagtgaaaaagatattgttctatctaatggtgtc
attcgtgcattatcaaaatacattggaccgaagtcgggaacggatcgtccatttttgtat
gataccaatgcagaatatttaccacctttacaagatgtcagtgactgtttcgattttctc
gcgtatcaacagtatggtagcgatgaccaacgcacgcaacgagcattaaataatttaagt
ccggttctcaatggggaacgatttgttccaggattaactttcccagaagagcaagatcgc
aaccgctggtatgacacaaaagagccgtatatggaaagtaacatgtataaagtagctcgt
tattcttatgaaaataatttagggggcatgttcctctatgccttagatcgcgatggtcgc
acctataatgaagacgatttaaatcagataaaaccttctaatttactttggacaaaaacg
gccattgcagagagtaaaggcgtttctcttgcagagatgaaagcggctgcgcaacactat
ttaaaacgaattagctacgccaacacagaccttgaagcacaaaataaagccgcagaagca
gtgacacaagcaacgacgctttatgatgtgaataaagctattttaggtggcgattatggc
caagggatttcaaatacctatgatgctgaattagaaaaaggcctgttagccattgactta
accactttatatcgtgcgttggatcaagcagttacagccattgaaaaggcagaaagctat
acaccagaaacgattcaagcactacaaacaacaaaagagacagtcgcaacagaacttgcg
ggaaaaacgtatacagccgcgcaagtgactacttggcaaacggaggtccaaacagctttg
gataatttaaaagagaaacaaacacaacctttaaaaagtgtcttctccattgatgcggga
agaaaatatttttccgtggagcaactggaagaattagtggccaaagccagtcaaaatggg
tacacagatgtccaattaattttaggaaatgatggcttacggtttatcttggatgatatg
tcggtcaatgtgaatggtaaaaaatacaaccacaaccgggtttcaaaagcaatccaacga
ggcaacaacgcgtattacaatgatcctaatggcaacgcgttaacacaaaaagaaatggat
cggttgttggcttttgcgaaagcgcgcaacatcaacatcattcccgtgattaacagtcca
ggacatatggatgccttgttagtggccatggaaaaactagcgattaaaaatcccgctttt
gatggctcaaaacgaacagtagatttagggaaccaaaaggcagtgaatttcacaaaggcg
attatcagtaagtacgtggcttatttttccgcgcatagtgaaattttcaattttggtggc
gatgagtatgcaaatgatgtcgacacaggcggttgggcgaaactgcaatcttctgggcgc
tacaaggattttgtcgcttatgcgaatgatttagctaaaataattaaagatgcgggcatg
cagccaatgagcttcaatgatggcatttattacaacagcgacgattctttcggtacattt
gacccagagattattatttcttattggacagccggttggagtgggtatgacgtagccaaa
cctgagtactttgttcaaaaaggacacaaaatttttaataccaatgatgcgtggtattgg
gtagctggcaatgttgattctggcatttatcaatatgacgatgctttagcaaatatgtcg
aaaaaagcatttacagatgtgccagcaggtagcccgaatcttccaattattggaagtatt
caatgtgtttggtatgatgaccctcgtcgtgactatgattttgaacgaatttatacgcta
atggatacgttctcggaaaattatcgtgagtatatggtggttaaataa

DBGET integrated database retrieval system