KEGG   Enterococcus faecalis D32: EFD32_0711Help
Entry
EFD32_0711        CDS       T02172                                 

Definition
aldehyde-alcohol dehydrogenase 2 family protein (EC:1.2.1.10)
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
efd  Enterococcus faecalis D32
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:efd00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    EFD32_0711
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EFD32_0711
   00620 Pyruvate metabolism
    EFD32_0711
   00650 Butanoate metabolism
    EFD32_0711
  Lipid metabolism
   00071 Fatty acid degradation
    EFD32_0711
  Amino acid metabolism
   00350 Tyrosine metabolism
    EFD32_0711
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    EFD32_0711
   00626 Naphthalene degradation
    EFD32_0711
Enzymes [BR:efd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     EFD32_0711
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     EFD32_0711
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
743712..746315
Genome map
AA seq 867 aa AA seqDB search
MNMVKTVKKEKTETVDVSSMIDELATKANVALKAMEDFTQEQVDHIVHQMAMAALDQHMP
LAKMAVEETGRGIYEDKAIKNMYASEYIWNNIKHDKTVGVINKDEQTGLMEIAEPVGVVC
GVTPTTNPTSTTIFKSLIALKTRNPIVFAFHPSAQKCSAEAARIVRDAAIAAGAPENCIQ
WIEQPSIDATSALMNHPGIAIVLATGGAGMVKSAYSTGKPALGVGPGNVPAYIEKTAKVK
RAVNDLIVSKSFDNGMICASEQAVIVDKEIYASVKAEFEAHNVYFVKPNELQKLEDAVMN
EGKYAVNPAIVGNSAEKIAELAGISVPKGTKILVAELEGAGPEYPLSREKLSPVLAMMKS
NNAEHAFELCEAMLNLGGLGHTAVIHTEDEELQVAFGLRMKACRILVNTPSAEGGIGNIY
NEMIPSLTLGCGSYGKNSVSKNVSAINLINIKTVAKRRNNMQWFKLPPKIFFEKNSLQYL
QKMENVERVMLVCDPGMVQFGYADIVRKELQKRKNDVKIEVFSDVEPNPSTNTVYAGTKM
MVDFQPDTVIALGGGSAMDAAKGMWMFYEHPDTEFFGAKQKFLDIRKRTYKIAKPEKTQF
VCIPTTSGTGSEVTPFAVITDSETHVKYPLADYALTPDVAIVDPQFVMSVPASVTADTGM
DVLTHAIESYVSVMASDYTRGLSLQAIKLVFDHLENSVKRPDMESREKMHNASTMAGMAF
ANAFLGICHSIAHKIGGEYGIPHGRTNAILLPHIIRYNAKDPSKHAMFPKYDYFRADTDY
ADIAKFLGLKGNTTAELVEALATAVADLGKSVGIDMNLKAQGVSQETLDTTVDRMAELAY
EDQCTTANPKEPLISELKQIILDAYVG
NT seq 2604 nt NT seq  +upstreamnt  +downstreamnt
atgaacatggttaaaacagtaaaaaaagaaaagacagaaacagttgatgtttcatcaatg
attgatgaattagcaacaaaagcgaatgtcgctttaaaagcaatggaagattttacacaa
gaacaagtagatcacattgtccatcaaatggcgatggcggcgttagaccaacatatgcct
ttagcaaaaatggctgtcgaagaaactggccgtggaatctatgaagataaagcaatcaaa
aatatgtatgcatctgaatacatttggaataatattaaacatgataaaacagtgggtgta
attaacaaagacgaacaaaccggcttaatggaaattgctgagccagttggcgtggtatgt
ggggtcacaccaacaacaaacccaacgtcaacaactatttttaaatcactaattgcctta
aaaacaagaaatccaattgtttttgctttccatcctagcgcacaaaaatgttcggcagaa
gcggcacgtattgtacgggatgcggcgattgcagcaggtgcaccagaaaattgtattcaa
tggattgaacaaccatcgattgatgcaacatctgctttgatgaatcatccagggattgcc
attgttttagcaactggtggcgcaggcatggtaaaatctgcatactcaacaggtaaacca
gcactaggcgttggtcctgggaacgtaccagcttatattgaaaaaacggctaaagtaaaa
cgtgcggttaatgatttaattgtttcaaaatcatttgataatggaatgatttgtgcttct
gagcaagcggtcattgtggataaagaaatttatgcttctgtcaaagctgagtttgaagca
cataacgtttacttcgtgaaaccgaatgaattacaaaaactagaagatgcagtgatgaat
gaaggcaaatacgcagtaaatccagcgattgtcggtaactctgcagaaaaaattgctgaa
ttagcaggaattagcgtaccaaaaggcacaaaaattttagtcgctgaattagaaggtgca
ggtccagaatatccattatcaagagaaaaattatcgccagttttagcaatgatgaaatca
aacaatgcagagcatgcttttgaactatgtgaagcgatgttaaacttaggtggtttagga
catacagcagtaattcatacagaagatgaagagttacaagttgcttttggtttacgtatg
aaagcttgtcgtattttagtgaatactccatcagcagaaggtggtattggtaacatttat
aacgaaatgattccatccttaacacttggttgtggttcatacgggaaaaactctgtttct
aaaaacgtatcagccattaacttaattaatattaaaacggtagcgaaacggagaaataat
atgcaatggtttaaattacctccaaaaattttctttgaaaaaaattctttacaatatcta
caaaaaatggaaaatgttgaacgtgtcatgttagtttgtgacccaggtatggttcaattt
ggctatgcagatatcgtacgtaaagagctacaaaaacgtaaaaatgatgtgaaaatcgaa
gtattttctgatgttgaaccaaacccatcaacaaatactgtttatgcaggtaccaaaatg
atggttgatttccaaccagatacagtgattgccttgggtggcggttctgcaatggacgca
gcgaaaggcatgtggatgttctatgaacacccagatacggagttctttggtgcaaaacaa
aaattcttagatatccgcaaacggacatataaaattgccaaaccagaaaaaacacaattt
gtttgtattccaactacttcaggaactggttcagaagttacaccatttgccgttattact
gatagtgaaacacacgtgaaatatccgttagcagactatgcgttaacaccagatgtagcg
attgttgatccacagttcgtaatgtctgtgccagcttcagtcactgcagatacaggtatg
gatgttttaacacatgctattgaatcttatgtctccgtaatggcttcagattacacacgt
ggtttaagtttacaagcaatcaagttagttttcgatcatttagaaaattcagtgaaacgt
ccagatatggaatctcgcgaaaaaatgcataatgcatcaaccatggcagggatggcattt
gctaatgcattcttaggtatttgtcactctattgctcataaaattggtggggaatatggc
attccacatggtcgtacaaatgcgattttattaccacatattattcgttacaatgcgaaa
gatccatcaaaacacgcaatgttccctaaatatgattacttccgcgccgatactgattat
gcagacattgcaaaattcttaggcttaaaaggaaatactaccgcagaattagtagaagct
ttagcaacagcagtagcagacttaggtaaatcagtcggaattgacatgaacttgaaagcc
caaggtgtctcacaagaaacattagacacaacggttgatcgtatggcagaacttgcatat
gaagaccaatgtacaactgcaaatccgaaagaaccattaattagtgaactaaaacaaatt
atcttagatgcttatgtaggataa

DBGET integrated database retrieval system