KEGG   Enterococcus faecalis OG1RF: OG1RF_10216Help
Entry
OG1RF_10216       CDS       T01882                                 

Gene name
bglA
Definition
6-phospho-beta-glucosidase (EC:3.2.1.86)
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
efi  Enterococcus faecalis OG1RF
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:efi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    OG1RF_10216 (bglA)
Enzymes [BR:efi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     OG1RF_10216 (bglA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
225942..227453
Genome map
AA seq 503 aa AA seqDB search
MVSLLCLKTEGKRDFMGFPENFLWGGATAANQYEGGYLSGGKGLSTLDAITGGSQTEPRR
ITYLTKEGQKASCTRDQALPEGAIGYIDEELYYPSHVATDFYHHYEEDIALFAEMGFKCF
RLSIAWSRICPNGTKEINEEGLAFYDKVFDALLRNGIEPVVTINHFDIPMYLADEYDGWK
NREVIDFFVFFCETIFTRYQDKVKYWMTFNEINFLRSWTQIGIHNNDKQSKYQAAHHLFV
ASAKAVELGHSINPDFQIGMMVAYIPSYPLSCKPEDVMAAVQFNREQEFYMDVQAKGYYP
AHKLKEFEREGMTIQMESEDLAIIQKGTVDYIGFSYYMSTVSTAYPEEVKYVGGNQMPAV
KNPYLQESEWGWAVDPLGLRISLCQLSDRYNMPLFVVENGFGAVDTLQEDGSIVDDYRID
YFKQHIEAMRTAVEEDGVNLIGYTPWGCIDLVSAGTGEMKKRYGFIYVDMDDQGQGTLKR
TKKKSFNWYKQVIASNGENLTTE
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atggtttctttgttatgcctaaaaacagagggaaagagggattttatgggatttccagaa
aattttttatggggcggcgcaacagctgctaaccaatatgaaggtggctacctttcagga
ggcaaaggtctgagtacattagatgcaattactggtggtagtcaaacagaaccgcgacgg
attacgtatttaactaaagagggccaaaaagcttcgtgtacgcgcgatcaagcattaccc
gaaggagcgattggttatatcgatgaagagttatactaccctagtcatgtagcgacggac
ttttaccatcattacgaagaagatatcgccttatttgcagaaatgggtttcaaatgtttt
cggctgtctatcgcctggagccggatttgcccaaatggaacaaaagagattaatgaagaa
ggcttagccttttatgataaagtttttgatgctttgctgcgcaatggaattgagcccgtt
gtgacgattaaccattttgatattccgatgtatttggccgatgaatatgatggttggaaa
aatcgtgaagtgattgatttctttgttttcttttgcgaaaccatttttacgcgttatcag
gataaagtgaagtattggatgacttttaatgaaattaattttttaagaagttggacgcaa
attgggattcacaataatgataaacaaagtaaatatcaagcagcgcatcatctatttgta
gcaagtgcgaaagcagttgaattaggacattccatcaatccagatttccaaattggtatg
atggtggcttatattccaagttatcctttgtcctgcaaacctgaggacgtgatggcagct
gttcaatttaaccgagagcaagaattttatatggatgtccaggctaagggctattatcca
gcgcataagctcaaagaatttgagcgtgaaggaatgacaattcaaatggagtcagaggat
ttagcgattattcaaaaaggaacagttgattatatcgggtttagttattatatgtcgacc
gtttcgactgcttatcccgaagaagtaaaatatgtcggaggcaaccaaatgcctgcggtt
aaaaatccttatttgcaagaatctgaatggggctgggctgtcgatcctttagggttaaga
atttcattgtgtcagttgtcagatcgttacaatatgccattgtttgtggttgaaaacggg
tttggtgcggtggatacattgcaagaggatggctcgattgtcgacgattaccgcattgat
tattttaaacaacatattgaagccatgagaaccgcagtagaagaagacggggttaactta
attggttatacgccatggggttgtattgacttagtttcagcagggactggcgaaatgaaa
aaacgttacggctttatctatgtagacatggatgaccaaggtcagggaaccttgaaacga
actaagaaaaaatcatttaattggtacaaacaagttatcgctagtaatggtgaaaactta
acaactgagtag

DBGET integrated database retrieval system