KEGG   Ethanoligenens harbinense: Ethha_2103Help
Entry
Ethha_2103        CDS       T01384                                 

Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
eha  Ethanoligenens harbinense
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eha00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Ethha_2103
Enzymes [BR:eha01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     Ethha_2103
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2251556..2252755
Genome map
AA seq 399 aa AA seqDB search
MWNARIVPIRSMCEAVEEVKKINVHSAAVELLAVKALHLCVRLEHVTPFAANILKQEMLG
KGGDAAVSKGVADFKDEYSDVLLMGTAAQFRRLLVKLEMQQGSLAEIGREVGAVLTHALT
REPRTFHCRGYDLPLGQKTYVMGILNVTPDSFSDGGSYADADEAVDRACQMIKDGADIID
IGGESSRPGYAPVPAEEEAARVLPVIRRLKASVSVPVSIDTMKAAVARQALEAGADIVND
IWGFQRDPDMARTAAAYDAGAVLMHNQDGTAYRDFMGDMLTFLRESIRLAKNAGLPDANL
SVDPGIGFGKDLAQNIESMRRLPELQALGYPVLLGTSRKSLIGKTLDLPADERVEGTAAT
VAFGIERGVDFVRVHDVKEMARVCKMTDALVRTPEEIHG
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgtggaatgcccggatcgtccccatccgctcaatgtgcgaggcggtggaggaagtaaaa
aaaatcaacgtgcacagcgcggcggtggaactgctcgccgtcaaagcgctgcacctttgc
gtccggctcgaacacgtcacgccgttcgcagccaacatcctcaagcaggaaatgctcggc
aaaggcggcgacgccgccgtgagcaagggcgtggccgatttcaaagacgaatactccgac
gtgctgctgatgggcactgcggcgcagttccgccgcctgctcgtcaagctggaaatgcag
cagggctcactggccgaaatcggtcgcgaggtcggcgcagtgctcacgcatgctcttacg
cgcgaacctcgcacgtttcactgccggggctacgacctgccgctcgggcaaaagacctat
gtgatgggcattctgaacgtcacgcccgactctttttcggacggcggttcctatgccgac
gcggacgaagcggtggatcgcgcctgtcagatgattaaggacggggcggacatcatcgac
atcggcggcgaatcctcccgcccgggctacgcgcccgttcccgccgaagaagaggccgcg
cgcgtgctgccggtcatccggcggctgaaagcctcggtgagcgttcccgtttccatcgac
accatgaaggccgccgtggcccggcaggcgctggaagcgggcgcagatatcgtcaacgac
atctggggcttccagcgcgacccggatatggcgcgcacggccgccgcatacgacgcgggc
gcggtgctcatgcacaaccaggacggcaccgcctaccgtgacttcatgggcgacatgctc
accttcctgcgcgaaagcatccggctggccaaaaatgccggcctgccggacgcgaacctc
tcggtagacccgggcatcggctttggcaaggaccttgcgcagaacatcgaatccatgcgc
aggctgccggagttgcaggcgcttggctatccggtgctgctcggcacctcgcgcaaatcg
ctcattggcaaaacattggacctgccggcggacgagcgggtggaaggcacggcggccacc
gttgcgttcggcatcgaacggggcgtggatttcgtgcgggtgcatgacgtaaaggagatg
gcgcgggtctgcaaaatgaccgacgcgctggtgcgcacgccggaggagatacatggataa

DBGET integrated database retrieval system