KEGG   Entamoeba histolytica: EHI_147000Help
Entry
EHI_147000        CDS       T00238                                 

Gene name
276.t00004
Definition
(RefSeq) hypothetical protein
  KO
K10739  replication factor A2
Organism
ehi  Entamoeba histolytica
Pathway
ehi03030  DNA replication
ehi03420  Nucleotide excision repair
ehi03430  Mismatch repair
ehi03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:ehi00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    EHI_147000 (276.t00004)
   03420 Nucleotide excision repair
    EHI_147000 (276.t00004)
   03430 Mismatch repair
    EHI_147000 (276.t00004)
   03440 Homologous recombination
    EHI_147000 (276.t00004)
DNA replication proteins [BR:ehi03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   RPA (replication protein A)
    EHI_147000 (276.t00004)
DNA repair and recombination proteins [BR:ehi03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    RPA (replication factor A)
     EHI_147000 (276.t00004)
   MMR (mismatch exicision repair)
     EHI_147000 (276.t00004)
  DSBR (double strand breaks repair)
   HR (homologous recombination)
     EHI_147000 (276.t00004)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA_anti-codon RMI2 BOF MatB DUF4131
Motif
Other DBs
NCBI-GeneID: 3404016
NCBI-ProteinID: XP_649713
UniProt: C4M8T1
AA seq 149 aa AA seqDB search
MAYANFDTETTGGFTQSSPRKNTENKSVVFPLTALSFIHTESNNKKQFTYKQVVLNTVVV
CGRITNIDIQNDVKRYTINDSTGSVVVGVYQIDSTEENIEVGQYIKCVGKIKKFSQETYI
LASRLPLVVDVNHMMTHLIECAYALSKLK
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
atggcatatgctaattttgatactgaaacaactggtggatttacacaaagttcaccaaga
aaaaatacagaaaataaaagtgttgtatttcctttaactgcattaagttttattcatact
gaatctaataacaaaaaacaatttacatataaacaagttgtattaaatactgttgttgtt
tgtggtagaataacaaatattgatatacaaaatgatgttaaaagatatacaattaatgat
tcaacaggaagtgttgttgttggggtatatcaaatagattcaacagaagaaaatattgag
gtcggtcaatatattaaatgtgttggtaaaattaaaaaattttcacaagagacatatatt
ttagcatctcgattaccacttgttgttgatgttaatcatatgatgactcatttgattgaa
tgtgcttatgctctttctaaacttaaatga

DBGET integrated database retrieval system