KEGG   Entamoeba histolytica: EHI_147000Help
Entry
EHI_147000        CDS       T00238                                 

Gene name
276.t00004
Definition
hypothetical protein
Orthology
K10739  
replication factor A2
Organism
ehi  Entamoeba histolytica
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ehi00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    EHI_147000 (276.t00004)
   03420 Nucleotide excision repair
    EHI_147000 (276.t00004)
   03430 Mismatch repair
    EHI_147000 (276.t00004)
   03440 Homologous recombination
    EHI_147000 (276.t00004)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 149 aa AA seqDB search
MAYANFDTETTGGFTQSSPRKNTENKSVVFPLTALSFIHTESNNKKQFTYKQVVLNTVVV
CGRITNIDIQNDVKRYTINDSTGSVVVGVYQIDSTEENIEVGQYIKCVGKIKKFSQETYI
LASRLPLVVDVNHMMTHLIECAYALSKLK
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
atggcatatgctaattttgatactgaaacaactggtggatttacacaaagttcaccaaga
aaaaatacagaaaataaaagtgttgtatttcctttaactgcattaagttttattcatact
gaatctaataacaaaaaacaatttacatataaacaagttgtattaaatactgttgttgtt
tgtggtagaataacaaatattgatatacaaaatgatgttaaaagatatacaattaatgat
tcaacaggaagtgttgttgttggggtatatcaaatagattcaacagaagaaaatattgag
gtcggtcaatatattaaatgtgttggtaaaattaaaaaattttcacaagagacatatatt
ttagcatctcgattaccacttgttgttgatgttaatcatatgatgactcatttgattgaa
tgtgcttatgctctttctaaacttaaatga

DBGET integrated database retrieval system