KEGG   Enterococcus hirae: EHR_02890Help
Entry
EHR_02890         CDS       T02160                                 

Definition
recombinase D
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
ehr  Enterococcus hirae
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:ehr03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(522476..525091)
Genome map
AA seq 871 aa AA seqDB search
MQPEEMPYFVGTVAAIFFQNPSNFYKVLLVRLTETTADYREKEIVVTGSFGEIQENELYR
FYGELVDHPKYGRQLKVERYEQEKPTTVNGIVGYLSSEKFPGIGKKTAEKIVEQLGEEAI
EKIIEEPSVLEQIAGLNQAKRDMIVETIRLNHGMDQVIMGLNRYGFGSQLAFSIYQTYKN
EALDIIQENPYQLVEDVEGIGFKRADNLAEQLGIAADSPRRIRAAVLHQIFQHAVQTGDT
YVPAETLLHQTIKILETSRPIEIQPDQVATVIIQLVEEGKIQQEETNLYENSLYFSEWGI
GNSIQRLLSRKKEINYDEKEVQKNIRRIEKIFGIQYGESQEKAISEAIRSPLFILTGGPG
TGKTTVINGIVNLFAELNGLELDPNKYTQEIFPILLAAPTGRAAKRMNETTGLPASTIHR
LLGLNGREKSPSVSTKELEGGLLIIDEMSMVDTWLANTLFKAIPTNMQVILVGDKDQLPS
VGPGQVLHDLLGIDQIPKVELNQIYRQGDGSSIIPLAHEIKEGHLPSDFLQNQKDRSFFR
SDAYSIEPLIAKIVEKAKNKGFTAQDIQVLAPMYRGPAGIDALNKMMQSIFNPGGAGRKE
VHWNETVYRIGDKVLQLVNTPELNVFNGDMGEITGIVLAKDSEDKVDELVIQFDANEVTY
KRNEWNKITLSYCCSIHKSQGSEFKMVILPMVHQYQRMLQRNLLYTAVTRSKELLILLGE
EQAYVTCVANESASRMTTLKKRIEENDSMSLVTRTKLVAYEDSLVGNDPFEEGNYTKAGE
TAHSVKTETSQQATQENVVDSTEGNVGDDLFTLSVEQDTTETAVESKVMEEAPTEQLPKT
YILTTEAIEKQWIDPMIGMEQEAVKEAFSSE
NT seq 2616 nt NT seq  +upstreamnt  +downstreamnt
atgcagccagaagaaatgccttattttgttggtacagttgccgcaatcttttttcaaaat
ccaagtaatttttataaagtactgttggttcggctcactgaaacaacagctgactatcgt
gaaaaagaaattgtggtcactggaagctttggtgagatccaagaaaatgagctttatcgt
ttttacggcgaattagtcgatcatcctaaatatgggcgacagttaaaggttgaacgctat
gagcaggagaaaccaacaacagtcaacgggatcgtgggttatctatccagtgaaaaattt
cctgggattggcaagaaaacagctgagaagatcgtggagcaactaggtgaagaagcgatt
gaaaaaatcatcgaagagccgtccgtattagaacaaatcgcaggcttgaatcaggccaaa
agagatatgatcgttgagacgattcgtttgaaccatgggatggatcaagtgatcatgggc
ttgaatcgttatggctttggtagtcagttagcttttagtatctatcaaacatataaaaat
gaagctttagatatcatccaggaaaatccctatcagttagtcgaagatgtggaagggatc
ggctttaaaagagcagataatcttgcagaacaattagggatcgcggctgattcaccaaga
cggattcgagctgcagttttacatcagatttttcaacatgctgttcaaactggcgataca
tatgtaccagctgaaacgcttcttcatcaaacaatcaaaattttggaaaccagtcgacca
atcgagatccaacctgatcaagtggcgacggtcattattcaacttgtggaagaaggtaag
atccaacaagaagaaaccaatctctatgaaaatagtctgtatttctcagaatgggggatc
ggtaactcgatccaacggttacttagtcggaaaaaagaaatcaactatgacgaaaaagaa
gtgcagaaaaacattcggcgaattgaaaaaatatttggtatccaatatggagaatcgcaa
gaaaaagcaatttcggaagcaatccggtcacctttatttattttaactgggggtcccggc
acagggaaaacaacagttatcaatgggatcgtcaacttgtttgcagaattaaatggctta
gaattagatccaaacaaatatacccaagaaatttttccgattctactggctgcaccaact
ggtcgagcagccaaacggatgaacgagacgacaggattacctgccagtacgatccatcga
ctactaggtttgaatggtcgagaaaaatctccttcagtaagtacgaaagaattagaaggt
gggttgttgatcatcgatgaaatgtcgatggtcgatacatggctagctaatacgctattt
aaagccatccctaccaacatgcaagtgattttagtaggagataaagatcaattaccatct
gtcggaccgggacaagtcttgcatgatttattaggaattgaccaaatcccgaaagtggaa
ttgaatcaaatttatcggcagggagacggatcaagtattatcccccttgctcatgaaatc
aaagaaggtcatttaccaagtgattttttgcaaaatcaaaaagatcgttctttctttcga
agcgatgcctacagtatcgaacctttaatcgcaaagattgttgaaaaagccaaaaataaa
ggcttcactgcacaagatatccaagtcttggcgccaatgtaccgtggtccagctggaatc
gatgcgttaaacaaaatgatgcagtcgatttttaaccctggaggtgcagggcggaaagaa
gtccactggaatgagactgtttatcgaatcggtgataaagtattacaattagtgaacaca
cctgaactcaatgtgtttaatggtgatatgggtgagatcacggggatcgtgttagcgaaa
gattcagaagataaagtggatgaattagtgattcaatttgatgcgaatgaagtgacttac
aaacgcaatgaatggaataaaatcaccctttcttattgttgttcgatccataaatctcaa
ggaagcgaatttaagatggtcattttaccgatggttcatcagtaccaacggatgttgcaa
cggaatcttctctacacggctgtcacaagaagtaaagaactattgattctactaggggaa
gaacaagcttacgttacctgcgttgcgaatgaatcggctagtcgaatgacgacattgaag
aagcggatcgaagaaaatgacagtatgagtcttgttacacggacgaagcttgtcgcttat
gaagattcccttgtaggtaatgatccttttgaagaaggaaattataccaaggcgggagaa
actgctcattccgtaaaaacagagacaagtcaacaagccactcaagaaaatgtcgtagat
tcaacggagggaaatgttggcgatgatctctttactttatcagtagaacaagacacaacc
gaaacggctgtcgaatcaaaagtgatggaagaagcaccaacagagcaactgccaaaaaca
tatattttaacaaccgaagcgattgaaaaacagtggattgatccaatgattgggatggag
caagaggctgtgaaagaagcgtttagctccgaataa

DBGET integrated database retrieval system