KEGG   Emiliania huxleyi: EMIHUDRAFT_236135Help
Entry
EMIHUDRAFT_236135 CDS       T02915                                 

Gene name
OLE1
Definition
fatty acid desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
ehx  Emiliania huxleyi
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:ehx00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    EMIHUDRAFT_236135 (OLE1)
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    EMIHUDRAFT_236135 (OLE1)
Enzymes [BR:ehx01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     EMIHUDRAFT_236135 (OLE1)
Lipid biosynthesis proteins [BR:ehx01004]
 Desaturase
  First
   EMIHUDRAFT_236135 (OLE1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 272 aa AA seqDB search
MDLKRFVVACAYRAGSPPFPVKSTLPPVLLSFHAATLYAAGSLLVAPPSAAHVAGGAGMY
ALLTFGITGGHHRYFSHRSYRTSRPFQFAIALLGSLAWQRGPIWWSSHHNHHHLHSDTGR
DPHSPVTGSWLWSHMGWYWASAEHDPPLDKFARTWRSFPELAALDKLHFAPGLLLAASLY
AYGGGGALLWGFVVPVTCCWNSIFAIGSLCHGDLGGGTRRFETGGADTSTNVWWGLAAHE
LDATYAALRALETLGLVWDLKFISSWSPNESL
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atggacctgaagcgcttcgtcgtcgcctgcgcctaccgcgccggctcgcccccgttcccc
gtcaagtctacgctgccgcccgtcctcctctccttccacgccgcgacgctctacgcggcg
ggctcgctgctggtggcgcctccgagcgcggcgcacgtcgcgggcggcgccggcatgtat
gcgctcctcacgtttggcatcacgggcgggcaccaccgctacttttcgcaccgctcgtac
cggacgagccgccccttccagttcgccatcgccctgctcggctcgctcgcgtggcagcgc
gggcccatctggtggagctcgcaccacaaccaccaccacctgcactcggacaccggcagg
gacccgcactcgcccgtcaccggctcgtggctctggtcgcacatgggctggtactgggcg
tcggcggagcacgacccgcccctcgacaagtttgcgcggacctggcgctcgttccccgag
ctcgccgccctcgacaagctccactttgcgcccggcctgctgctggcggcgtcgctgtac
gcgtacggaggcggcggcgcgctgctgtggggtttcgtcgtgccggtcacgtgctgctgg
aacagcatcttcgcgatcggatcgctctgccacggcgacctcggaggcggcacccgccgc
ttcgagacgggcggcgcggacacctccaccaacgtgtggtgggggctggccgcgcacgag
ctcgacgccacctacgccgcgctgcgcgcgctcgagacgctcggcctcgtgtgggatctc
aagtttatcagcagttggtctccaaacgaatcgttgtaa

DBGET integrated database retrieval system