KEGG   Eggerthella lenta: Elen_0605Help
Entry
Elen_0605         CDS       T00984                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
ele  Eggerthella lenta
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ele00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Elen_0605
DNA repair and recombination proteins [BR:ele03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Elen_0605
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
772282..772878
Genome map
AA seq 198 aa AA seqDB search
MYAAPSIQKLLDELERLPGVGPKSAQRIAYWILNADKATALRLSEAIAEVKETVRFCSRC
FNYAEDDLCEICQSSKRDAGIICVVSEPRDIPPIERTAVYNGVYHVLGGALSPMEGIGPD
ELRIAQLMKRLASDEVREVVLATNPNVEGETTATYLARLIKPLGIAVTRPASGLPVGGDL
EFADEVTLGRAIEARRPL
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgtacgctgcgccgtccattcagaaactgctcgacgagcttgagcgcttgccgggcgtg
gggccgaagtcggcgcagcgtatcgcgtactggatcctcaacgccgacaaggcgacggcg
ctgcgcctgtcggaggccatcgccgaggtgaaggaaacggtgcgcttctgctcgcgctgc
ttcaactacgccgaggacgacctgtgcgagatctgccagtcgtccaagcgcgacgcgggc
atcatctgcgtggtcagcgagccgcgcgacatcccgcccatcgagcgcaccgcggtgtac
aacggcgtgtaccacgtgctgggcggcgccctttccccgatggagggcatcggccccgac
gagctgcgcatcgcccagcttatgaagcgcctcgcatccgacgaggtgcgcgaagtggtg
ctggccacgaaccccaacgttgagggggagaccacggcgacctacctcgcccgactcatc
aagccgctcggcatcgccgtcacccgtcccgccagcggcctgcccgtcggcggcgacctc
gagttcgccgatgaggttaccctcggccgcgctatcgaagccagacggccgctgtag

DBGET integrated database retrieval system