KEGG   Erythrobacter litoralis: ELI_06010Help
Entry
ELI_06010         CDS       T00315                                 

Gene name
rph
Definition
ribonuclease PH
Orthology
K00989  
ribonuclease PH [EC:2.7.7.56]
Organism
eli  Erythrobacter litoralis
Brite
Enzymes [BR:eli01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.56  tRNA nucleotidyltransferase
     ELI_06010 (rph)
Transfer RNA biogenesis [BR:eli03016]
 Prokaryotic Type
  3'processing and CCA adding factors
   3'processing factor
    ELI_06010 (rph)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(1243420..1244133)
Genome map
AA seq 237 aa AA seqDB search
MRPSGRAPDEMRAITIETGYTKHAEGSCLIGFGDTKVLCTASVEERLPPWLRGKGQGWVT
GEYSMLPRATHTRGNREAARGKQSGRTQEIQRLIGRSLRAVVDLEKLGERQITLDCDVIQ
ADGGTRTASISGAWIALRLAVSGLMEQGQIKDDPITGKIAAISCGIYNGTPVLDLDYAED
SNADADANFVLIEGGKIAEAQATAEGATYDEEGLMRLLRLAQIGCAQIFKSQDEATK
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgcgaccttccggacgcgcgcccgacgagatgcgcgctatcaccatcgagaccggctac
accaagcatgccgaaggctcctgcctgatcggcttcggcgacaccaaggtgctgtgcacc
gccagcgtcgaagaacgcttgccgccgtggctgcgcggcaagggacagggttgggtcacc
ggcgaatactccatgctgccacgcgcgacgcatactcgcggcaaccgcgaggccgcacgc
ggcaagcagtccgggagaacgcaggaaattcagcgccttatcgggcgcagcttgcgggcc
gtggtcgatctggaaaagctcggcgaacgtcagatcacgctcgattgcgacgttatccag
gccgatggtggcacgcgcaccgcgtcgatctccggcgcgtggattgcgcttcgcctcgcc
gtgagcggtttgatggagcaagggcaaatcaaggacgaccccatcaccggcaagatcgcc
gcaatcagctgcgggatctacaatggcacgccggtgctcgatctcgactatgcggaagac
tccaacgccgatgccgatgccaatttcgtgctgatcgaaggcggcaagatcgcagaagcc
caggccacggccgaaggcgcgacctatgacgaggaaggcttgatgcgcctgctccgcctc
gcccagatcggttgcgcgcagatcttcaagtcgcaggacgaggcgacgaagtga

DBGET integrated database retrieval system