KEGG   Erythrobacter litoralis: ELI_06010Help
Entry
ELI_06010         CDS       T00315                                 

Gene name
rph
Definition
ribonuclease PH
Orthology
K00989  
ribonuclease PH [EC:2.7.7.56]
Organism
eli  Erythrobacter litoralis
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(1243420..1244133)
Genome map
AA seq 237 aa AA seqDB search
MRPSGRAPDEMRAITIETGYTKHAEGSCLIGFGDTKVLCTASVEERLPPWLRGKGQGWVT
GEYSMLPRATHTRGNREAARGKQSGRTQEIQRLIGRSLRAVVDLEKLGERQITLDCDVIQ
ADGGTRTASISGAWIALRLAVSGLMEQGQIKDDPITGKIAAISCGIYNGTPVLDLDYAED
SNADADANFVLIEGGKIAEAQATAEGATYDEEGLMRLLRLAQIGCAQIFKSQDEATK
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgcgaccttccggacgcgcgcccgacgagatgcgcgctatcaccatcgagaccggctac
accaagcatgccgaaggctcctgcctgatcggcttcggcgacaccaaggtgctgtgcacc
gccagcgtcgaagaacgcttgccgccgtggctgcgcggcaagggacagggttgggtcacc
ggcgaatactccatgctgccacgcgcgacgcatactcgcggcaaccgcgaggccgcacgc
ggcaagcagtccgggagaacgcaggaaattcagcgccttatcgggcgcagcttgcgggcc
gtggtcgatctggaaaagctcggcgaacgtcagatcacgctcgattgcgacgttatccag
gccgatggtggcacgcgcaccgcgtcgatctccggcgcgtggattgcgcttcgcctcgcc
gtgagcggtttgatggagcaagggcaaatcaaggacgaccccatcaccggcaagatcgcc
gcaatcagctgcgggatctacaatggcacgccggtgctcgatctcgactatgcggaagac
tccaacgccgatgccgatgccaatttcgtgctgatcgaaggcggcaagatcgcagaagcc
caggccacggccgaaggcgcgacctatgacgaggaaggcttgatgcgcctgctccgcctc
gcccagatcggttgcgcgcagatcttcaagtcgcaggacgaggcgacgaagtga

DBGET integrated database retrieval system