KEGG   Escherichia coli P12b: P12B_c0752Help
Entry
P12B_c0752        CDS       T02030                                 

Gene name
ybcS
Definition
lysozyme
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
elp  Escherichia coli P12b
Brite
Enzymes [BR:elp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     P12B_c0752 (ybcS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
815944..816441
Genome map
AA seq 165 aa AA seqDB search
MPPSLRKAVAAAIGGGAIAIASVLITGPSGNDGLEGVSYVPYKDIVGVWTVCHGHTGKDI
MLGKTYTKAECKALLNKDLATVARQINPYIKVDIPETTRGALYSFVYNVGAGNFRTSTLL
RKINQGDIKGACDQLRRWTYAGGKQWKGLMTRREIEREICLWGQQ
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgcctccatcattacgaaaagccgttgctgctgctattggtggcggagcaattgctata
gcatcagtgttaattactggcccaagtggtaacgatggtctggaaggtgtcagctacgta
ccatacaaagatatcgttggcgtatggactgtatgtcacggacacaccggaaaagacatc
atgctcggtaaaacgtataccaaagcagaatgcaaagcactcttgaataaagaccttgcc
actgtcgccagacaaattaacccgtacatcaaagtcgatataccggaaacaacgcgcggc
gctctttactcattcgtttacaacgtgggtgctggcaatttcagaacatcgacgcttctt
cgcaaaataaaccagggcgatatcaaaggcgcatgtgatcagctacgtcgctggacatat
gctggcggtaagcaatggaaaggtctcatgactcgtcgtgagattgagcgtgaaatctgt
ttgtggggtcagcaatga

DBGET integrated database retrieval system