KEGG   Escherichia coli P12b: P12B_c4121Help
Entry
P12B_c4121        CDS       T02030                                 

Gene name
aceB
Definition
(GenBank) Malate synthase A
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
elp  Escherichia coli P12b
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:elp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    P12B_c4121 (aceB)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    P12B_c4121 (aceB)
   00630 Glyoxylate and dicarboxylate metabolism
    P12B_c4121 (aceB)
Enzymes [BR:elp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     P12B_c4121 (aceB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
4525413..4527014
Genome map
AA seq 533 aa AA seqDB search
MTEQATTTDELAFTRPYGEQEKQILTAEAVEFLTELVTHFTPQRNKLLAARIQQQQDIDN
GTLPDFISETDSIRDADWKIRGIPADLEDRRVEITGPVERKMVINALNANVKVFMADFED
SLAPDWNKVIDGQINLRDAVNGTISYTNEAGKIYQLKPNPAVLICRVRGLHLPEKHVTWR
GEAIPGSLFDFALYFFHNYQALLAKGSGPYFYLPKTQSWQEAAWWSEVFSYAEDRFNLPR
GTIKATLLIETLPAVFQMDEILHALRDHIVGLNCGRWDYIFSYIKTLKNYPDRVLPDRQA
VTMDKPFLNAYSRLLIKTCHKRGAFAMGGMAAFIPSKDEERNNQVLNKVKADKSLEANNG
HDGTWIAHPGLADTAMAVFNDILGSRKNQLEVMREQDAPITADQLLAPCDGERTEEGMRA
NIRVAVQYIEAWISGNGCVPIYGLMEDAATAEISRTSIWQWIHHQKTLSNGKPVTKALFR
QMLGEEMKVIASELGEERFSQGRFDDAARLMEQITTSDELIDFLTLPGYRLLA
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atgactgaacaggcaacaacaaccgatgaactggctttcacaaggccgtatggcgagcag
gagaagcaaattcttactgccgaagcggtagaatttctgactgagctggtgacgcatttt
acgccacaacgcaataaacttctggcagcgcgcattcagcagcagcaagatattgataac
ggaacgttgcctgattttatttcggaaacagattccattcgtgatgctgactggaaaatt
cgtgggattcctgcggacttagaagatcgtcgcgtagagattaccggacccgtagagcgc
aagatggtgatcaacgcgctcaacgccaatgtgaaagtctttatggccgatttcgaagat
tcactggccccggactggaacaaagtgatcgacgggcaaattaacctgcgtgatgcggtt
aacggcaccatcagttacaccaatgaagcaggcaaaatttaccagctcaagcccaatcca
gcggttttgatttgtcgggtacgcggtctgcacttgccggaaaaacatgtcacctggcgt
ggtgaggcaatccccggcagcctgtttgattttgcgctctatttcttccacaactatcag
gcactgttggcaaagggcagtggtccctatttctatctgccgaaaacccagtcctggcag
gaagcggcctggtggagcgaagtcttcagctatgcagaagatcgctttaatctgccgcgc
ggcaccatcaaggcgacgttgctgattgaaacgctgcccgccgtgttccagatggatgaa
atccttcacgcgctgcgtgaccatattgttggtctgaactgcggtcgttgggattacatc
ttcagctatatcaaaacgttgaaaaactatcccgatcgcgtcctgccagacagacaggca
gtaacgatggataaacccttcctgaatgcttactcacgcctgttgattaaaacctgccat
aaacgcggtgcttttgcgatgggcggcatggcggcgtttattccgagcaaagatgaagag
cgcaataaccaggtgctcaacaaagtaaaagcggataaatcgctggaagccaataacggt
cacgatggcacatggatcgctcacccaggccttgcggacacggcaatggcggtattcaac
gacattctcggctcccgtaaaaatcagcttgaagtgatgcgcgaacaagacgcgccgatt
actgccgatcagctgctggcaccttgtgatggtgaacgcaccgaagaaggtatgcgcgcc
aacattcgcgtggctgtgcagtacatcgaagcgtggatctctggcaacggctgtgtgccg
atttatggcctgatggaagatgcggcgacggctgaaatttcccgtacctcgatctggcag
tggatccatcatcaaaaaacgttgagcaatggcaaaccggtgaccaaagccttgttccgc
cagatgctgggcgaagagatgaaagtcattgccagcgaactgggcgaagaacgtttctcc
caggggcgttttgacgatgccgcacgcttgatggaacagatcaccacttccgatgagtta
attgatttcctgaccctgccaggctaccgcctgttagcgtaa

DBGET integrated database retrieval system