KEGG   Escherichia coli NA114: ECNA114_1165Help
Entry
ECNA114_1165      CDS       T01998                                 

Gene name
nagZ
Definition
Beta hexosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
ena  Escherichia coli NA114
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:ena00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:ena00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1201535..1202560
Genome map
AA seq 341 aa AA seqDB search
MGPVMLDVEGYELDAEEREILAHPLVGGLILFTRNYHDPAQLRELVRQIRAASRNHLVVA
VDQEGGRVQRFREGFTRLPAAQSFAALLGMEEGGKLAQEAGWLMASEMIAMDIDISFAPV
LDVGHISAAIGERSYHADPQKALAIASRFIDGMHEAGMKTTGKHFPGHGAVTADSHKETP
CDPRPQAEIRAKDMSVFSSLIRENKLDAIMPAHVIYSDVDPRPASGSPYWLKTVLRQELG
FDGVIFSDDLSMEGAAIMGSYAERGQASLDAGCDMILVCNNRKGAVSVLDNLSPIKAERV
TRLYHKGSFSRQELMDSARWKAISARLNQLHERWQEEKAGH
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
gtgggtccagtaatgttggatgtcgaaggttacgaactggacgcggaagagcgtgaaata
ctggcgcatccgctggtgggagggctgattctctttacgcgaaactatcatgatcctgcc
cagttacgtgaactggtgcgccagatccgcgcagcatcgcgaaatcatctggtggtggcg
gtagatcaggaaggtggacgcgtgcagcgttttcgtgaaggttttacccgcttgccagcg
gcacaatcattcgctgcgctgttgggaatggaagaaggcggaaaactggcgcaagaggca
ggttggttgatggccagcgaaatgattgctatggatattgatatcagctttgcgccagtg
ctggacgtcgggcatatcagcgcggcgattggcgagcgttcttatcatgccgatccacaa
aaagccctggcaattgccagccggtttattgatggtatgcatgaagccggaatgaaaact
accgggaaacacttcccaggtcacggtgcagtaacggcagactcacacaaagaaacaccg
tgcgacccacgtccgcaagcggagattcgcgctaaagatatgtcggtcttcagttcctta
atccgcgaaaataaactcgacgccattatgcctgcgcatgtgatctacagtgatgttgat
ccgcgtccggcgagcggttctccctactggctgaaaaccgttttgcgtcaggaattgggt
tttgacggcgtgattttctctgacgatttatcgatggaaggcgcagcgattatgggcagt
tatgccgagcgtggacaggcatcactggatgcaggttgcgatatgatcctggtctgcaat
aatcgtaaaggggccgtcagcgtgttagataatctgtcaccgatcaaggcagaacgtgtt
acacgtttgtatcataaaggttcattttcgcgacaggaactgatggactcggctcgctgg
aaagcgatcagcgcccgtctgaatcagttacatgaacgctggcaggaagagaaggcaggt
cattaa

DBGET integrated database retrieval system