KEGG   Enterobacter cloacae subsp. cloacae ATCC 13047: ECL_01727Help
Entry
ECL_01727         CDS       T01231                                 

Definition
(RefSeq) bifunctional indole-3-glycerol phosphate synthase/phosphoribosylanthranilate isomerase
  KO
K13498  
indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
enc  Enterobacter cloacae subsp. cloacae ATCC 13047
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:enc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    ECL_01727
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ECL_01727
Enzymes [BR:enc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     ECL_01727
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     ECL_01727
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1739568..1740926)
Genome map
AA seq 452 aa AA seqDB search
MQTVLAKIVADKAIWVEARKAQQPLASFQNDVVPSSRRFYDALQGARTAFILECKKASPS
KGVIREDFDPARIAGIYKHHASAISVLTDEKYFQGSFDFLPVVSSIAPQPILCKDFIIDP
YQIWLARFYQADACLLMLSVLDDEQYRQLAAVAHSLNMGVLTEVSNEEELERAIALQAKV
VGINNRDLRDLSIDLNRTRQLAPRLGSGVTVISESGINSYAQVRELSHFANGFLIGSAMM
AHDDLNAAVRRVLLGENKVCGLTREQDAQAAYEAGAIYGGLIFVDASPRAVSDEQARKVI
AAAPLSYVGVFRNADIADVTAKAEALSLSAVQLHGDEDQAYIDALRAGLAPQVQIWKAQS
VGSTLPARNLNHVDKYVLDNGQGGTGQRFDWSLLNGEALDNVLLAGGLSPDNCVEAAKTG
CAGLDFNSGVESQPGIKDASKLASVFKTLRAY
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgcagaccgttttagcgaaaatcgttgccgataaggccatctgggtggaagcccgcaaa
gcgcagcagccgcttgccagttttcagaacgacgtcgtcccaagcagccgtcgtttctat
gatgccctgcagggcgcgcgcaccgcatttattcttgagtgcaaaaaagcctccccgtcg
aaaggcgttatccgtgaggatttcgatccggcgcgtattgccggtatttataagcatcat
gcgtcggcgatctccgtgctgacggatgagaaatatttccagggcagcttcgattttctg
cctgttgtcagcagcatcgcgccgcaaccgattctgtgcaaagactttattatcgacccg
tatcagatctggctggcgcgtttttaccaggctgacgcctgcctgctgatgctctcggtg
ctcgacgacgagcagtatcgccagctggctgcggtggcgcacagcctcaacatgggcgtg
ctgaccgaggtgagcaacgaagaagagctggagcgagccattgcactgcaggcgaaagtg
gtcgggattaacaaccgcgatctgcgcgatctgtcaattgacctgaatcgtacgcgtcag
ctggcaccgcgtctgggctctggcgtgactgttatcagtgaatccgggatcaacagctac
gcccaggtgcgtgagctgagccactttgccaacggtttcctgattggctctgcgatgatg
gcacatgacgatctcaatgccgcagtgcgtcgggtgctgttgggtgaaaacaaagtgtgc
ggcttaacccgcgaacaggatgcccaggccgcctatgaggcgggggctatttacggcggg
ttgatctttgtggacgcctcaccgcgtgcggtgagcgatgaacaggcacgcaaggtgata
gcggcagccccactcagttatgtgggcgtcttccgtaacgctgatattgcggacgttacg
gcaaaagccgaagcgttatcccttagtgcagtacaactgcacggtgatgaagatcaggca
tacatcgatgccctgcgtgccgggctggctcctcaggttcagatctggaaagcgcagagc
gtgggcagcaccctgccagcacgtaacctgaatcatgttgataaatacgtgctcgataac
ggccagggcggtacaggccaacgttttgactggtcactgctgaacggcgaagcgctggac
aatgtcctgctggcgggtggacttagcccggacaactgtgtggaagcagccaaaaccggc
tgcgcgggcctcgatttcaattcaggcgtagagtcgcaaccgggcatcaaagatgccagt
aagctggcctcggtatttaaaactctgcgtgcatattaa

DBGET integrated database retrieval system