KEGG   Enterobacter cloacae subsp. cloacae ATCC 13047: ECL_04595Help
Entry
ECL_04595         CDS       T01231                                 

Definition
DNA polymerase III subunit chi
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
enc  Enterobacter cloacae subsp. cloacae ATCC 13047
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:enc00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    ECL_04595
   00240 Pyrimidine metabolism
    ECL_04595
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    ECL_04595
   03430 Mismatch repair
    ECL_04595
   03440 Homologous recombination
    ECL_04595
Enzymes [BR:enc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     ECL_04595
DNA replication proteins [BR:enc03032]
 Prokaryotic Type
  DNA Replication Elongation factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     ECL_04595
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4712548..4712991
Genome map
AA seq 147 aa AA seqDB search
MKNATFYLLDNDTHQDGLSAVEQLVCEIAAERWRAGKRVLIACEDEQQAIRLDEALWARP
PESFVPHNLSGEGPRGGAPVEIAWPQKRNSSARDILISLRIDFADFATAFTEVVDFVPYE
ESLKQLARERYKAYRLAGFNLNTATWK
NT seq 444 nt NT seq  +upstreamnt  +downstreamnt
atgaagaatgcaacgttctaccttctggacaatgacacccatcaggatggcctcagcgcc
gtagaacagctggtgtgtgaaattgccgcagaacgttggcgcgcaggtaaacgggttctg
attgcctgtgaagatgaacagcaggcgattcgtcttgacgaagcgctgtgggcgcgcccg
ccggagagttttgtaccgcataacctgtctggcgaagggccgcgcggcggcgcaccggtc
gagatagcctggccgcaaaagcgcaacagcagcgcgcgcgatattctgattagcctgcgg
atagattttgcagattttgccaccgctttcacagaagtggtagactttgtcccttacgaa
gaatccttgaaacaactggcgcgcgaacgctacaaagcgtaccgcctggctggttttaac
ctgaatacggcaacctggaaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system