KEGG   Enterococcus sp. 7L76: ENT_17330Help
Entry
ENT_17330         CDS       T02585                                 

Definition
thymidine kinase (EC:2.7.1.21)
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
ene  Enterococcus sp. 7L76
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ene00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    ENT_17330
Enzymes [BR:ene01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     ENT_17330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1700186..1700770)
Genome map
AA seq 194 aa AA seqDB search
MAQLFFKYGAMNSGKTIEILKVAHNYEEQDKPVVLMTSGLDTRDGVGKVSSRIGLRRDAI
PIFEETNVFDLINDLSYKPFCVLVDECQFLNKHHVIEFARIVDELDIPVMAFGLKNDFRN
ELFEGSKYLLLYADKLEELKTICWFCHKKATMNLHYIDGKPVYEGDQVQIGGNEAYYPVC
RKHYFHPKTVNEEQ
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atggctcaattatttttcaagtatggcgcaatgaacagtggtaaaaccattgaaatctta
aaagtagcacacaattacgaagaacaagacaaaccagttgttttgatgaccagtggacta
gatacacgtgatggtgttgggaaagtatccagtcgcatcggattacgcagagatgctatt
ccaatttttgaagaaaccaatgtctttgacttgattaatgatttgtcttacaaacctttt
tgcgtattagtcgatgaatgtcaatttttaaacaagcatcatgtcattgaatttgcacga
attgttgacgaattagatattccagtaatggcatttgggctaaagaatgattttagaaat
gaattatttgaaggctcaaagtatttacttttatatgcagacaaattagaagaattaaaa
acgatttgctggttctgtcataaaaaagcaactatgaacttgcactatattgatggcaaa
cccgtttatgaaggggatcaagtccaaattggtgggaatgaagcctactatcctgtttgt
cgcaaacattattttcatccaaaaacagtgaatgaagaacagtaa

DBGET integrated database retrieval system