KEGG   Enterobacter cloacae subsp. dissolvens SDM: A3UG_00245Help
Entry
A3UG_00245        CDS       T02159                                 

Definition
Beta-glucosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
enl  Enterobacter cloacae subsp. dissolvens SDM
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:enl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    A3UG_00245
Enzymes [BR:enl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     A3UG_00245
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(48492..49865)
Genome map
AA seq 457 aa AA seqDB search
MKYTFPDNFWWGSASSALQTEGTREGETTWDYWFAREPNRFHNGVGPQHTSTFYQHWKTD
IQLLKQLNHNSFRTSISWARLIPDGIGEVDPKAVEFYNQVIDELIAQGITPFITLFHFDM
PMAMQEIGGWENREVVDTYARYAQICFDLFGDRVLHWFTFNEPIVPVEGGYLYDFHYPNV
VDFRRAATVAYHTVLAHAKAVQAYRAGHYAGEIGIVLNLTPSYPRSQNPADVKAAHIADL
MFNRSFLDPVLRGEYPADLVALLKSYDQLPACKPEDSFLIAEGKIDLLGINYYQPRRVKC
RDSAVNPQAPFMPEWFFDNYEMPGRKMNPYRGWEIYEPGIYDILVNLRDNYGNPRCFISE
NGMGVENEQRFIENGQINDQYRIDFISGHLTWLHKGISEGCNCLGYHMWTFIDNWSWCNA
YKNRYGFVQLDLTTQQRTIKKSGEWFAATSLHNSFDK
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgaaatatacctttcccgataatttctggtggggcagcgcaagctccgctctccagacc
gaagggacacgagagggtgaaaccacatgggattactggtttgcccgcgagccgaaccgt
tttcacaacggcgtggggccgcagcatacctccacgttttatcagcactggaaaacggac
attcagctgttaaaacagctgaaccacaacagctttcgcacttccataagctgggcacgc
ctgatccccgacggtatcggtgaagttgatccaaaggcggtcgaattttataaccaggtc
attgatgagctgatcgcgcagggcattacgccgtttatcaccctgttccatttcgacatg
ccgatggcgatgcaggagatcggcggctgggaaaaccgggaggtagtggacacttacgcc
cgctatgcgcagatttgcttcgacctgtttggcgaccgcgtgctgcactggtttaccttt
aacgagccgattgtcccggttgagggcggttatctgtacgatttccactacccgaacgtg
gtggatttccgtcgggcggccaccgtggcgtatcacaccgtgctggcccacgcgaaggcc
gttcaggcctaccgcgccggacattacgcgggtgagatcggcatcgtgctcaacctgaca
ccgtcctacccgcgctcgcaaaacccggcggacgtgaaggcggcgcacatcgcggatctg
atgtttaaccgcagcttcctcgacccggttctgcgcggtgaatacccggccgatctggtg
gcactgctgaaatcttacgaccagcttcccgcctgtaaaccggaggacagcttcctgatt
gcggaagggaaaatcgacctgctcggcattaactattaccagccgcgtcgcgtgaagtgt
cgcgacagcgcggtgaacccgcaggcgccgtttatgccggagtggttctttgataactac
gagatgccgggccgcaagatgaacccgtaccgtggctgggaaatttacgagccgggtatt
tacgatattctggttaacctgcgcgacaattacggcaacccacgctgttttatttctgaa
aacggaatgggcgtcgaaaatgagcagcgctttattgaaaatggccagataaacgatcaa
taccgtattgattttatttccggacatttaacctggctgcataaaggtattagcgaaggg
tgcaattgccttggctaccatatgtggacctttattgataactggtcgtggtgtaatgcg
tataaaaaccgctatggctttgtccagctcgatttaactacgcaacagcgcaccattaaa
aagagcggagagtggtttgccgccacctctttacataatagtttcgataaatag

  All links  
No link information was found.   
DBGET integrated database retrieval system