KEGG   Enterobacter cloacae subsp. dissolvens SDM: A3UG_10365Help
Entry
A3UG_10365        CDS       T02159                                 

Definition
(GenBank) enoyl-CoA hydratase-isomerase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
enl  Enterobacter cloacae subsp. dissolvens SDM
Pathway
enl00071  Fatty acid degradation
enl00280  Valine, leucine and isoleucine degradation
enl00281  Geraniol degradation
enl00310  Lysine degradation
enl00360  Phenylalanine metabolism
enl00362  Benzoate degradation
enl00380  Tryptophan metabolism
enl00410  beta-Alanine metabolism
enl00627  Aminobenzoate degradation
enl00640  Propanoate metabolism
enl00650  Butanoate metabolism
enl00903  Limonene and pinene degradation
enl00930  Caprolactam degradation
enl01100  Metabolic pathways
enl01110  Biosynthesis of secondary metabolites
enl01120  Microbial metabolism in diverse environments
enl01130  Biosynthesis of antibiotics
enl01212  Fatty acid metabolism
Module
enl_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:enl00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    A3UG_10365
   00650 Butanoate metabolism
    A3UG_10365
  Lipid metabolism
   00071 Fatty acid degradation
    A3UG_10365
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    A3UG_10365
   00310 Lysine degradation
    A3UG_10365
   00360 Phenylalanine metabolism
    A3UG_10365
   00380 Tryptophan metabolism
    A3UG_10365
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    A3UG_10365
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    A3UG_10365
   00281 Geraniol degradation
    A3UG_10365
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    A3UG_10365
   00627 Aminobenzoate degradation
    A3UG_10365
   00930 Caprolactam degradation
    A3UG_10365
Enzymes [BR:enl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     A3UG_10365
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: AFM59807
Position
2248271..2249038
Genome map
AA seq 255 aa AA seqDB search
MSELLVTRHGRVLQLTLNRPAARNALNNALLTQLAEQLEAAACDNSISACVIYGSERCFA
AGADLNEMAEKDLPATLNDSRPQLWKRIDAFNKPLIAAVNGFALGAGCELALLCDVVIAG
DNARFGLPEITLGIMPGAGGTQRLIRCVGKSLASRMVLTGESITAQQAQRAGLVSDVFPA
SLTLEYALKQAALMARHSPLALQAAKQALRQSQEVPLQAGLAQERQLFTLLSATEDRREG
IDAFLQKRTPDFKGR
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaactcctcgttacccgtcatggccgtgtgctgcagttgacgctcaaccgtccg
gcggcacgcaacgccctcaacaatgcactgctgacgcagcttgccgaacaactggaggcc
gcagcctgcgacaacagtatttctgcctgcgtgatttacggcagcgagcgctgctttgcg
gccggggccgatctcaacgaaatggcagaaaaagatctgcccgccaccctgaacgatagt
cgtcctcagctgtggaagcggatagacgccttcaataaaccgctgattgccgccgtgaac
ggttttgcactcggggctggctgcgagctggccctgttgtgcgacgtggtgattgccggt
gacaacgcccgcttcggtctgccggaaatcacgcttgggatcatgcccggtgcgggcggc
acgcagcgcctgatccgctgcgtgggtaaatcgctcgccagcagaatggtgctgaccggg
gaaagtattacggcgcagcaggctcagcgagccggtctggttagcgacgttttcccggct
tcgctgacgctggaatacgccctgaaacaggcggcactgatggcgcgccactcgccgctg
gcgctacaggcggctaaacaggcgctgcgccagtcgcaggaggtgccgctgcaggcgggt
ctggcccaggagcgtcaactgttcacgctgctctcggccacggaagacaggcgagaaggc
atcgacgccttcttacagaaacgtactcccgactttaaaggacgctaa

DBGET integrated database retrieval system