KEGG   Enterobacter cloacae subsp. cloacae ENHKU01: ECENHK_01275Help
Entry
ECENHK_01275      CDS       T02315                                 

Definition
(GenBank) isocitrate lyase
  KO
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
eno  Enterobacter cloacae subsp. cloacae ENHKU01
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:eno00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ECENHK_01275
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    ECENHK_01275
Enzymes [BR:eno01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     ECENHK_01275
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
273997..275301
Genome map
AA seq 434 aa AA seqDB search
MKTRTQQIEELKKEWTQPRWEGIRRPYSAEEVVKLRGSVNPECTLAQNGAAKMWKLLHGG
SKKGYINSLGALTGGQALQQAKAGIEAVYLSGWQVAADANLASSMYPDQSLYPANSVPSV
VDRINNTFRRADQIQWAAGIEPNDPRFIDYFLPIVADAEAGFGGVLNAFELMKSMIEAGA
AAVHFEDQLASVKKCGHMGGKVLVPTQEAIQKLVAARLAADVLGVPTLVIARTDADAADL
ITSDCDPYDSEFITGERTSEGFYRTHAGIEQAISRGLAYAPYADLVWCETSTPDLALAKR
FADAIHAKYPGKLLAYNCSPSFNWQKNLDDKTIASFQQQLSDMGYKYQFITLAGIHSMWF
NMFDLAHAYAQGEGMKHYVEKVQQPEFAAGKEGYTFVSHQQEVGTGYFDNVTTIIQGGAS
SVTALTGSTEEAQF
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacccgtacccaacaaatcgaagaactgaagaaagaatggacacaaccgcgctgg
gaaggcattcgtcgtccgtacagcgcggaagaagtggtgaaattacgcggctcggtcaat
ccggaatgcacgctggcgcaaaatggcgcggcgaaaatgtggaagctgctgcacggtggt
tccaaaaagggttatatcaatagcctcggggcgttgaccggcggtcaggcactgcagcag
gcgaaggccggtattgaggctgtttatctttccggctggcaggttgcggcggatgccaac
ctggcatccagtatgtatccggatcagtccctctacccggcgaactccgtgccgtcggtg
gttgatcgaatcaacaacaccttccgccgtgcggatcagatccagtgggcggcaggcatc
gaacccaacgatccgcgctttattgactacttcctgccgatcgtcgcggatgcggaagcg
ggtttcggcggcgtgctgaacgcgttcgagctgatgaaatcaatgattgaggccggtgca
gcggccgttcacttcgaagatcagctggcatcggtgaagaagtgcggacacatgggcggt
aaggtgctggttccgacccaggaagcgattcagaagctggttgccgcgcgtctggcggca
gacgtgctcggcgtgccgacgctggtcattgcccgtaccgatgcggatgcggctgacctg
atcacctctgactgcgatccgtacgacagcgagttcatcaccggtgagcgcaccagtgaa
gggttctatcgtacccatgcaggcatcgaacaggcgatcagccgtggcctggcgtatgcc
ccttacgccgacctggtctggtgtgaaacctccacgccggatctggcgctggcaaaacgt
tttgccgatgccattcatgcgaaatatccgggcaaactgctggcctataactgctcgccg
tccttcaactggcagaagaatctggatgataaaaccatcgccagcttccagcagcagctt
tctgacatgggctacaagtaccagttcattaccctggcgggtatccacagcatgtggttc
aacatgttcgaccttgcacatgcttatgcgcagggtgaaggcatgaaacactacgtcgag
aaggttcagcagccagaattcgccgccggaaaagagggttataccttcgtttctcaccag
caggaagtgggaacgggctacttcgacaacgtgaccactatcattcagggcggtgcctcc
tccgtcaccgccttaacgggatcaaccgaagaagcacagttctaa

DBGET integrated database retrieval system