KEGG   Enterobacter sp. 638: Ent638_0219Help
Entry
Ent638_0219       CDS       T00507                                 

Definition
isocitrate lyase (EC:4.1.3.1)
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
ent  Enterobacter sp. 638
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:ent00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ent638_0219
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Ent638_0219
Enzymes [BR:ent01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     Ent638_0219
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
258981..260285
Genome map
AA seq 434 aa AA seqDB search
MKTRTQQIEELQKEWTQPRWEGIERPYSAEEVVKLRGSVNPECTLAQLGAAKMWRLLHGE
SKKGYINSLGALTGGQALQQAKAGIEAVYLSGWQVAADANLASSMYPDQSLYPANSVPSV
VDRINNTFRRADQIQWSSGIEPNDPRYVDYFLPIVADAEAGFGGVLNAFELMKSMIEAGA
AAVHFEDQLASVKKCGHMGGKVLVPTQEAIQKLVAARLAADVLGVPTLVIARTDADAADL
ITSDCDPYDSEFITGERTSEGFYRTHAGIEQAISRGLAYAPYADLVWCETSTPDLALAKR
FADAIHAKYPGKLLAYNCSPSFNWQKNLDDTTIASFQQQLSEMGYKYQFITLAGIHSMWF
NMFDLAHAYAQGEGMRHYVEKVQQPEFASSQKGYTFASHQQEVGTGYFDKVTTIIQGGAS
SVTALTGSTEESQF
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacgcgtacccaacagatcgaagaattacaaaaagagtggacacagccgcgctgg
gaaggcattgaacgcccgtacagcgcagaggaagtggtgaaattacgcggctcagtcaat
ccggaatgcacgctggcacagcttggcgcggccaaaatgtggcgtctgctgcacggtgaa
tcgaaaaaagggtacatcaatagcctcggtgcgctgacgggcggccaggcgttacagcag
gcgaaagcgggaatcgaagcggtctatctttccggctggcaggtggcggctgatgctaat
ttggcgtccagcatgtacccggatcaatcgctctatccggctaactccgtgccgtcggtt
gtcgatcggatcaacaacacgtttcgtcgtgccgatcagatccagtggtcttcggggatt
gagccgaacgacccgcgctatgtcgattatttcctgccgatcgtcgccgatgcagaagcc
ggttttggcggcgtgctgaatgccttcgagctgatgaagtccatgattgaagccggtgca
gcggcggttcactttgaagatcagttggcgtccgtgaagaagtgcgggcatatgggcggc
aaagtattggtcccgactcaggaagccattcagaaactggtcgccgcgcgtctggcggca
gatgtattgggtgtcccgacgctggttatcgcccgtaccgatgccgatgccgctgacctg
atcacctccgactgcgatccttacgacagcgaattcattaccggcgagcgcaccagcgaa
ggtttctatcgtactcatgcgggtatcgagcaggccatcagccgtggcctggcttatgcg
ccgtatgcagaccttgtgtggtgtgaaacctccacgccagatctggcgctggcaaaacgc
tttgccgatgctatccatgccaaataccctggcaaactgctggcctacaactgctcgcca
tcgtttaactggcagaagaatctggatgacaccaccatcgccagcttccagcagcagctc
tctgagatgggctacaaatatcaatttattacgctcgcgggcattcacagcatgtggttc
aacatgttcgacctggcgcatgcttacgcgcagggtgaaggcatgcgccactatgtcgaa
aaagtgcagcagccagaatttgcatcgagccaaaaaggctacacctttgcctctcatcag
caggaggtcggaacgggctacttcgacaaagtcaccaccatcattcagggcggcgcctca
tccgtcaccgccttgaccggctcgaccgaagaatcacagttctaa

DBGET integrated database retrieval system