KEGG   Enterobacter sp. 638: Ent638_2921Help
Entry
Ent638_2921       CDS       T00507                                 

Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
ent  Enterobacter sp. 638
Pathway
ent00010  Glycolysis / Gluconeogenesis
ent00052  Galactose metabolism
ent00500  Starch and sucrose metabolism
ent00520  Amino sugar and nucleotide sugar metabolism
ent00521  Streptomycin biosynthesis
ent01100  Metabolic pathways
ent01110  Biosynthesis of secondary metabolites
ent01120  Microbial metabolism in diverse environments
ent01130  Biosynthesis of antibiotics
ent01200  Carbon metabolism
Module
ent_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ent_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ent00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ent638_2921
   00052 Galactose metabolism
    Ent638_2921
   00500 Starch and sucrose metabolism
    Ent638_2921
   00520 Amino sugar and nucleotide sugar metabolism
    Ent638_2921
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Ent638_2921
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Ent638_2921
Enzymes [BR:ent01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Ent638_2921
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase PaaX_C
Motif
Other DBs
NCBI-ProteinID: ABP61585
UniProt: A4WD05
Position
complement(3169675..3170640)
Genome map
AA seq 321 aa AA seqDB search
MTKYALVGDVGGTNARLALCDIDTGEISQAKTYSGLDYPSLEAVVRVYLDEHQVGVEDGC
IAIACPITGDWVAMTNHTWAFSIAEMKKNLGFAHLEIINDFTAVSMAIPMLKPEHLIQFG
GAEPVEGKPIAVYGAGTGLGVSHLVHVDKRWISLPGEGGHVDFAPNSEEEGIILHELRAE
LGHVSAERVLSGPGLVYLYRAIVKSDNRLPENLQPKDITERALADSCTDCRRALSLFCVI
MGRFGGNLALNLGTFGGVYIAGGIVPRFLEFFKASGFRGGFEDKGRFKSYVQDIPVYLIV
HDNPGLLGSGAHLRQTLGQYL
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaatatgctttagtaggtgatgtaggcggcacgaatgcgcggctggcattatgc
gatattgataccggcgaaatttctcaagcaaagacctattccgggctggattacccaagt
cttgaagcggtggttcgcgtgtatctggatgagcatcaggtcggtgtcgaggatggttgt
atcgctatcgcctgtccgattaccggtgactgggtggcgatgacgaatcacacctgggca
ttttccattgccgaaatgaaaaaaaatctcggcttcgcgcatctggaaatcatcaacgac
tttacagccgtttcgatggcgatcccaatgctcaaacctgaacatcttattcagtttggc
ggcgcggaaccggtcgaaggcaagccgattgccgtttatggcgcgggtacgggactgggt
gtttcacatctggttcacgtcgataaacgctggatcagtttgccgggtgagggcggccac
gttgatttcgcgccgaacagcgaagaagaaggcatcattcttcatgaactgcgcgccgaa
ctgggccacgtttctgccgagcgcgtgctgtccggccctgggctggtttatctttatcgc
gcgattgtgaaatccgataatcgtctgccggaaaacttacaacccaaagacattaccgag
cgcgcactggcggacagctgcacagactgtcgtcgcgcgctgtcactgttctgcgtgatt
atgggtcgctttggcggcaatctggcgttaaatctcggcacgtttggcggagtttacatc
gcgggtggcattgtgccgcgtttcctggagttctttaaagcgtctggtttccgtggcggg
tttgaagataaagggcgttttaaatcctatgtgcaggacattccggtttatctgatcgtg
catgataatccaggtctgctgggttcaggagcgcatctacgccagacgctgggccaatac
ctctga

DBGET integrated database retrieval system