KEGG   Eremothecium cymbalariae: Ecym_1429Help
Entry
Ecym_1429         CDS       T02237                                 

Definition
(RefSeq) hypothetical protein
  KO
K01694  
tryptophan synthase [EC:4.2.1.20]
Organism
erc  Eremothecium cymbalariae
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:erc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Ecym_1429
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Ecym_1429
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Ecym_1429
Enzymes [BR:erc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Ecym_1429
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(889712..891829)
Genome map
AA seq 705 aa AA seqDB search
MSELLKQTFANAKREGRRALITFMTAGYPTMDDTVNIMKGFQDGGVDIIELGLPFTDPLA
DGPTIQVSNSTALQGGITMKKTLELLRQARDAGVVIPVLLMGYFNPILNYGEEVFIRDAA
EAGANGFLIVDLPPEEAVNIRGFVRKNGLSLVPLVAPSTTDERLDLMAQLADTFIYVVSR
MGTTGARHQVSSALPELIHRVRSHVGDMNLAVGFGVSNKEQFDFVATLADGVVIGSKVID
LVGATEDKDKYNIVKNYTEEILGGVKHPLLSKDEFERMHRESINGSDLEESLDFSEKQRR
FPPNFGVFGGQYIPEVMHGCMRQLELAFEHAVDDLKFWEEFKSLYPYIGRPSTLHKAERL
TEYCGGAQIWLKREDLNHTGSHKINNAIGQVLLAKRLGKKKIIAETGAGQHGVATATACA
KFGMECTIFMGAEDVRRQALNVFRIKLLGAEVVVVQNGSKTLRDATSEAFRYWVSNLETT
HYIVGSAIGPHPYPTLVRTFQSVIGNETKQQFAELNGGKLPDAIVACVGGGSNASGMFSP
FEHDPVKLLGIEAGGQGMDTKFHSATLTSGRPGVLHGVKTYVLQDEDGQVNNTHSISAGL
DYPAVGPELASWKASGRVEFTAATDAQAVEAFRLLSQLEGIIPALESSHAIYGAIQLAKT
MKPDQSLIINISGRGDKDVQTIAEVLPKIGPEIGWDLRFQADPSI
NT seq 2118 nt NT seq  +upstreamnt  +downstreamnt
atgtcggaattgttaaagcagacttttgcaaatgccaaaagggagggtcgtcgtgcattg
atcacgtttatgactgctgggtatccgacgatggacgatacggttaatatcatgaagggg
tttcaagatggaggggttgatattattgagctaggtttgccgtttactgatccgcttgca
gatggacctactattcaggtgtcgaatagcactgcattgcagggaggtattacgatgaaa
aaaacgcttgagcttcttcgccaggctagggatgcgggtgttgtaattccggtactgttg
atgggatatttcaatccgattctgaattatggggaggaggttttcattcgggatgcggcg
gaggcaggagccaacgggtttctgattgttgatttaccgcctgaggaagctgtgaatatc
cgggggtttgttaggaagaatggattgagtttggtgcctttggtagcaccttccacaact
gatgagcggttggatttgatggctcagcttgcagatacattcatttatgttgtgtcaagg
atgggtactacgggtgctaggcaccaggtttcttctgctctgcctgaactgatccatcgt
gtgaggtctcatgtgggggatatgaacttagctgtgggatttggtgtttcaaataaagag
cagtttgattttgtcgctactttggcggacggtgttgttattggttcaaaggttattgac
ttggttggtgctactgaggataaagacaagtacaatattgtaaagaattacactgaggaa
atattgggtggcgtcaagcatcctttgttatctaaggatgagtttgaaaggatgcatcgt
gaatctataaatgggtctgatttggaggaatccctcgatttctctgagaagcaacggagg
tttcctcccaattttggagttttcggaggtcagtacatccccgaagtgatgcatggatgt
atgaggcaattagagttggcttttgaacatgcggtagatgatctgaagttctgggaagag
ttcaagagcttatacccctatattggaaggccttccacccttcacaaagcagaaagattg
actgaatattgtggaggtgcacagatttggctcaagagagaagatttgaaccatactggt
tcccacaaaatcaacaacgctatcggtcaagttttgcttgcgaaaaggctgggcaagaaa
aagattattgctgaaacaggtgcagggcagcatggtgtggctacggccacagcttgtgct
aaatttggtatggaatgtactattttcatgggtgcagaagatgtacgtcgtcaggcgttg
aatgtttttaggatcaagctgcttggtgcagaggttgttgttgtgcaaaacggttctaaa
actttgagagatgcgacttctgaggcattccgttactgggtttcgaatcttgaaactacc
cattatatcgttggatctgctattggcccgcacccttatcctactttggtgagaacattc
caaagtgtgataggtaatgaaactaaacaacagtttgctgagttaaatggcggtaaacta
ccagatgctatagttgcatgtgttggcggaggttcgaacgcttcagggatgttttctccc
tttgaacatgatcctgtaaagcttttgggtattgaggccggcggtcaagggatggatacg
aagttccattctgcaacattaacctccgggagacctggtgtccttcatggtgtaaaaact
tatgttctacaagatgaagatggtcaggtaaacaacacgcactctatctcagcaggtctg
gattaccctgctgttgggccagaattggcatcctggaaggcctcaggtcgtgtagaattc
accgcagcaaccgatgctcaagctgttgaagcatttaggttactatcccaattagaaggt
attattcccgcattagaatcctctcatgctatatatggcgcgattcaattagccaaaact
atgaaacctgatcagagtttgattatcaatatttctggtagaggtgacaaggatgttcaa
actatcgcagaagtattgcccaaaataggtcctgaaattggatgggatctaaggttccag
gctgatccttctatctag

DBGET integrated database retrieval system