KEGG   Eremothecium cymbalariae: Ecym_5099Help
Entry
Ecym_5099         CDS       T02237                                 

Definition
hypothetical protein
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
erc  Eremothecium cymbalariae
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5:219768..221093
Genome map
AA seq 441 aa AA seqDB search
MPLKWRTKNNQKGDFKRAKIEGAEGDNSDSVKDGERIEQENEKMSSGEGDSGEREGEAED
GDQPMEEEIEDEKKGIVKFMFDGVEYKFKERPSVIEEREGKIEFRVVNNDNTKENMMVLT
GLKNIFQKQLPKMPKEYIARLVYDRSHLSMAVIRKPLTVVGGITYRPFEKGEFAEIVFCA
ISSTEQVRGYGAHLMNHLKDYVRATTNIKYFLTYADNYAIGYFKKQGFTKEITLDKSVWM
GYIKDYEGGTLMQCFMLPKIRYLDAAKILLLQEAAIQRKIRTISQSHVVRRGLDQFKDLD
NIEPLDPMSVPGLREAGWTPEMDALAQRPKRGPHYAAMQNVLTELQNHAAAWPFLQPVNK
DEVPDYYEFIKEPMDLSTMEVKLENNRYEKMEDFIYDARLIYSNCRAYNGENTSYFKYAN
RLEKFFNAKMKEIPEYSHLID
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgcctcttaaatggagaactaagaataatcagaaaggggattttaagagggcgaagata
gaaggggccgaaggagacaattctgattcagttaaagatggtgaacgcatagagcaagag
aatgaaaagatgagttctggagagggagattcaggggagcgagaaggtgaggctgaggac
ggggaccagcctatggaggaggagatagaggatgaaaagaagggtattgttaaattcatg
tttgatggagttgaatataagttcaaagagcggccaagtgtgattgaagaacgagagggg
aagattgagtttcgtgttgtaaacaatgataataccaaggagaatatgatggtattgacg
gggttgaagaatatttttcagaagcagctacctaaaatgccgaaggagtacatagcgaga
ttggtatacgatcgatcgcatctttcgatggctgtgatacggaaaccattaactgttgtg
ggtggtattacatatagaccatttgagaagggtgagtttgcggagattgtgttttgtgcg
ataagttccactgaacaggttcgtgggtatggtgcacacttaatgaatcatttgaaagat
tacgtgcgggccactacgaacatcaaatacttcttaacgtacgcggacaactatgcaata
ggttacttcaaaaagcaagggtttacaaaggagattaccctggataaaagtgtgtggatg
gggtacatcaaagactacgaagggggtaccttaatgcagtgctttatgttacccaagatc
aggtacttggatgcagccaagatattgttgctccaggaagctgccatccaaagaaaaata
agaaccatatctcagagccatgtggtgaggcgagggctcgaccaattcaaagatcttgat
aatattgaaccactcgaccctatgagtgtgcccggtcttagagaagctggctggactccc
gaaatggatgcactggcacaaaggcctaagagaggtccacattatgcagctatgcaaaat
gtattaaccgaacttcagaaccatgctgcggcttggccatttttgcaacccgttaataag
gatgaagtcccagattactacgagtttattaaagaacctatggatctgagcactatggaa
gtcaagttggaaaataataggtatgagaagatggaagacttcatatatgatgcccgctta
atctatagcaattgtcgagcctacaatggggaaaatacatcctacttcaagtacgcgaat
agactagagaagttcttcaacgcaaagatgaaggagattccggagtattcccacttaata
gattag

DBGET integrated database retrieval system