KEGG   Eremothecium cymbalariae: Ecym_5544Help
Entry
Ecym_5544         CDS       T02237                                 

Definition
hypothetical protein
Orthology
K11841  
ubiquitin carboxyl-terminal hydrolase 10 [EC:3.1.2.15]
Organism
erc  Eremothecium cymbalariae
Brite
Enzymes [BR:erc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     Ecym_5544
Peptidases [BR:erc01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Ecym_5544
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5:1102256..1104760
Genome map
AA seq 834 aa AA seqDB search
MPDSKENQGSYSMYPPSPVPPAAQIPPGAAAAAANSYIYTNPYHSQYNYGYPLGIEIYPS
QTMQYMGYHQPAMAYGSYGGPAQGAVPMKKKFYSNNTNYKKDNQSNGNVGAGSMMLNGVN
HSNGNNNVANMDSNKPVQVTIKNLFKFELGNSNSVRIDGLKIEYPMYVNTTAEEFAKAKV
KRHILRLEALKDLESKKDVPVSKKDSDQKDRKSNSEQKFREAASTEDDKVESKRHTEHAE
IRDSKNEEQSIRKDRHDAEVSNSSNRDPSPKKDEYKQSQNLGKKKEDSESNSFTASTNVK
SEDKRGDAPVKTLKPWSQIASSAVSKTKPISITTSTLSKREKKYVPSNIKGSEPVGAVAL
RMSFDRDYKKYVNDTAPETTKAINTIVPRGILNKGNICFMSSVLQVLLFCKPFISMLNAV
CTRTGTKSSCSLPPLLDACLDFYKEFDKGNFEKERGEKQSISGNNGKASKGVTRLPLADV
IDPESFYKSISKLSMFRELQWGHQEDAEEFLTHFLDQLHEEFVSAINTLSSNEIMNLLQS
ISDDELKTEFIRSLPKYKSSDFVRKMSAELKTLIENYGSNPESESNSNGDEDICEWHEVS
KKGKRAKNAVKRTMEVEPSPIMSIFGGEYRSVLDIPQNKESQSITLDPFYTLHLHISDPE
VNDLESAFKKFSDFEYLPYKADSGNDVEAKKQAFIDRLPQVLLIQLKRFEFVNNNSERRE
LVNYNAYNGRIEKICKWIKYDHDLTIPKEALSSINAKFLFSDNDTSYKLTGVVYHHGLSS
SGGHYTADVLHQDEEKWYRIDDTTVTEINKEEVVTGGEEGSHSRTAYILIYQRA
NT seq 2505 nt NT seq  +upstreamnt  +downstreamnt
atgccagattcgaaagaaaaccaaggaagttattctatgtatccaccatctccagtacct
ccagcagcccaaataccaccaggagctgcagctgcagctgctaactcatatatttacaca
aatccgtaccattctcaatataactatggttacccactcggaatagaaatttatccttcc
caaacgatgcaatatatggggtatcatcagccagcaatggcttatggtagttatggtggg
ccagcacaaggtgcagttccaatgaagaagaagttttacagcaataataccaactataag
aaggacaaccaatctaatggcaatgtaggtgctggttctatgatgcttaatggggtaaac
cacagcaatgggaataacaacgttgctaatatggattctaataaaccagtgcaggtaacc
attaaaaacttgttcaagtttgaactgggcaatagcaacagtgttcgtatagatggctta
aaaatcgaatatcctatgtatgtgaacactactgctgaggaattcgcgaaggctaaggta
aagaggcatatattaagattggaagctttgaaggacttggagagtaagaaggatgtgcct
gtatctaaaaaggattctgatcagaaggacagaaagtcaaattcagaacaaaaattcaga
gaggccgcttctaccgaagatgataaagttgaatctaaaaggcatactgaacatgcagaa
ataagggattctaaaaatgaagagcagtctataagaaaggacagacacgatgctgaagtc
tcgaatagttctaacagggatccttcacctaaaaaagatgaatacaaacaatcacagaat
ttgggtaagaaaaaggaggattctgagtccaattcttttactgcatcaactaatgtgaaa
agtgaggacaaaagaggtgatgcgccagttaaaacgttaaagccgtggtcccaaatagct
tcaagcgccgttagcaaaactaaacctatttctataactacatcaacgttatcaaaaaga
gagaagaagtatgttccatctaacattaaaggttcagaacctgtcggtgcggttgcatta
aggatgagctttgacagggactacaagaaatatgtgaatgacactgctccagaaacaaca
aaggctattaacacaattgttcccaggggtatattgaacaagggtaatatctgctttatg
tcttctgttctacaagtgttgctattttgcaaaccatttatcagcatgttgaatgcagtt
tgcacaagaacaggaacaaaatcaagttgttcacttccgccgttgctagatgcctgttta
gacttctataaggaatttgataaaggtaatttcgaaaaggaaagaggtgagaaacagtca
atttctggaaataacgggaaagcctctaaaggtgtgactcgtttgcccttagctgatgta
attgatcctgaatcattttacaagagtatctcaaaattgtctatgttcagagagttacaa
tggggccaccaagaagatgcggaggaatttttaactcattttctagatcaattacatgaa
gagtttgtttctgctataaacactttgagctctaatgaaatcatgaatttgttgcagagt
atatcagatgatgagctaaaaactgagtttataagatcattgcctaagtataagagttct
gatttcgtaaggaaaatgagcgcagaattaaaaacactgattgaaaattacggcagcaat
ccagaatctgaaagcaattctaacggagatgaagatatttgcgaatggcatgaagtaagt
aagaaaggtaaaagggctaaaaatgctgtgaaaagaacaatggaagtagagccttctcct
attatgtccatatttggtggcgaatacagatcagtattagacattccacaaaacaaggag
tcgcaatcaataactttggatcctttctacacattacatttacacatttcagatcccgaa
gtaaacgatctagaatcagctttcaagaagttcagcgatttcgaatatttaccatataag
gctgattcggggaatgatgtagaagctaaaaaacaagcatttattgatcgcttacctcag
gtgctgcttattcagttgaagagatttgaatttgttaataataattcagaaagaagagag
ttggttaattataatgcgtacaatgggcgcattgaaaaaatttgcaaatggatcaagtat
gaccacgacttaactattccaaaggaagcgctttcatcaattaatgcaaaattcttgttc
tctgataatgacactagctacaagttaactggtgtggtttatcaccatgggctttcatcc
agcggcgggcattacacagcagacgtactacatcaggatgaagaaaaatggtacagaatt
gatgatacgactgttacggaaataaataaagaagaagttgtcacaggtggcgaagaggga
tctcattcaagaacagcatacattctgatctatcaaagagcttaa

DBGET integrated database retrieval system