KEGG   Eremothecium cymbalariae: Ecym_6242Help
Entry
Ecym_6242         CDS       T02237                                 

Definition
hypothetical protein
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
erc  Eremothecium cymbalariae
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:erc00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6:453080..453850
Genome map
AA seq 256 aa AA seqDB search
MKEIVFLKNKTIPEDKYQEQFESKGFNTHFVPLIQHTHLPNQALELFKNKEYLSDLKHII
VTSQRTVECLYEEVIPSLSSDEKSKLFNKTVYVVGPATQEFMTRCGFKYVRGGSETGNGN
LLADFIIKELLVDKTPTNWNPLLFLVGEIRKDTITKKLTSAGLNVQEVVTYKTQPLEDNY
ERFKQVITDSSWVVIFSSQGTKEIVQYVKDRRIKIASIGPSTAKYLLDSGLEPEVVSKNP
DPVSLYESIMPNLHKS
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgaaggagattgtattcctgaagaataagactatacctgaagataagtaccaggaacag
tttgaatcaaaaggttttaacactcactttgttcccctaattcagcatacccacttgcca
aatcaagccctagaattgttcaagaataaggaatacttatcggatttgaaacatatcatt
gtcacatctcagagaactgtggagtgcctatatgaagaagtgattccatctttatcaagt
gatgaaaagtccaaattatttaataaaacagtttatgtggtgggtccggcaactcaagaa
tttatgaccagatgtggattcaaatacgttaggggtggctcagagacggggaatggcaac
ttgttagcagattttattatcaaggagctcttagttgataaaacaccaacgaactggaac
ccattgctgtttctcgtgggagagatcagaaaggataccattacaaagaaattgacgtct
gcaggtttgaatgtccaagaggtagttacatacaaaacacaacctttggaagacaactat
gaaaggtttaagcaggttataactgatagttcttgggtagtaatatttagttcccaaggc
accaaagaaattgttcaatatgtgaaggataggaggattaaaattgcatccattggtcca
tccactgcaaaatatctgttagatagcgggttggaaccagaggtggttagtaaaaaccct
gatcctgtatcgttgtatgaatctataatgccgaatcttcataaaagctga

DBGET integrated database retrieval system