KEGG   Ehrlichia ruminantium Gardel: ERGA_CDS_06970Help
Entry
ERGA_CDS_06970    CDS       T00232                                 

Gene name
cycM
Definition
cytochrome c-like protein
Orthology
K08738  
cytochrome c
Organism
erg  Ehrlichia ruminantium Gardel
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:erg00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    ERGA_CDS_06970 (cycM)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    ERGA_CDS_06970 (cycM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1105280..1105804)
Genome map
AA seq 174 aa AA seqDB search
MDGFQLNKIFTAILFACFIVLFVSNVTDLLYNPEPHAEPVRGYKVDVEQQGLIEESAAVP
DVQVDIQALVAQANITKGKEISKKCVSCHTFEKGGANKVGPNLWHIIGNKKAHLGDAFNY
SKAMLNIGGTWEYHDLFQFLTKPQAYVKGTRMAFAGISKPQDIADLIAYMKSLE
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
atggatggttttcaattaaataaaatatttacagctattttgtttgcatgttttatagta
ttgtttgttagtaatgtaactgacttattgtataatcctgagcctcatgctgaaccagta
aggggttataaagtagatgtagagcaacagggtctgatagaagaaagtgcagctgttcct
gatgtacaagtagatatccaggctcttgtagcacaagctaatataacaaagggaaaagag
atttcaaaaaagtgtgtgtcatgtcatacttttgagaaaggtggagcaaataaagttggt
ccaaacctatggcatataatagggaacaaaaaagcacatttaggggatgctttcaattat
tcaaaggcaatgttgaatattggtggaacatgggagtatcatgacttgtttcagttttta
acaaagcctcaggcttatgttaaaggtacacgtatggcatttgctgggatttcaaagcct
caagatatagcagatttaatagcatatatgaagtctttagaatag

DBGET integrated database retrieval system