KEGG   Eubacterium rectale DSM 17629: EUR_12620Help
Entry
EUR_12620         CDS       T02587                                 

Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
ert  Eubacterium rectale DSM 17629
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ert00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    EUR_12620
  Amino acid metabolism
   00340 Histidine metabolism
    EUR_12620
Enzymes [BR:ert01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     EUR_12620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1276775..1278064
Genome map
AA seq 429 aa AA seqDB search
MRTLKLTKDSQKNILESLLKRSPNNYTEYESTVNEIINNVKENRDKAVFEYTKKFDKADV
DASNIRVTEEEIKEAYELVDEKLLAVIKKALVNIRKYHEKQLQNSWFTTEDGIILGQKVT
PIAKAGVYVPGGKAVYPSSVLMNVLPAKVAGVEKIVMCTPCGADGKVYPSTLVAANEAGV
DEIYKVGGAQAIAAMAFGTESVPKVDKIVGPGNIFVALAKKAVFGYVSIDSIAGPSEILV
LADETANPRYVAADLLSQAEHDEMASAILITTSDELAKKVSEEVDKFVEVLSRKEIIEKS
LENYGYILVAEDMDEAIDAVNDIASEHMEIVTRDPFSVMTKIKNAGAIFIGEYSSEPLGD
YFAGPNHVLPTNGTAKFFSALSVDDFIKKSSIISYSREALERIHTDIEQFAECEKLTAHA
NSIKVRFED
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgagaactttaaaacttacaaaggattcacagaaaaacatattggagagcctgcttaaa
agaagccctaacaactatacagagtatgagagcacggtaaatgagattataaacaatgta
aaggaaaaccgtgacaaggctgtttttgaatacacaaagaaatttgataaagcggatgtg
gatgcatcaaatatccgtgtcacagaggaagaaataaaggaagcatatgagctggttgat
gagaagcttcttgccgttataaaaaaggctcttgtaaatatcagaaaatatcacgagaag
cagctgcagaactcatggtttacaacagaggacggcatcattttaggacagaaggtcaca
cctatagcaaaggcaggagtatatgtgccgggcggcaaggctgtctatccttcatctgta
ctgatgaacgtgcttcctgcaaaggtagcaggcgttgaaaagatagttatgtgtacacca
tgtggagctgacggcaaggtatatccttccacacttgtagccgcaaacgaggccggagta
gatgaaatctacaaggtaggcggtgcacaggctatcgctgcaatggcatttggtacagag
agtgtgccaaaggtagacaagattgttggaccgggaaatatctttgttgcccttgccaaa
aaggctgtgtttggatatgtcagcattgattcaatcgcaggacctagcgagattttggtg
cttgcagatgagactgcaaatccacgctatgtggcagcagatttactttcacaggccgag
catgatgagatggcatcagctatcttgatcacaacaagtgatgagcttgcaaagaaagta
tcagaggaagttgataagtttgttgaggtcctctcaagaaaagaaatcattgagaaatct
cttgaaaactacggatatatacttgttgcagaggatatggatgaggcaattgatgcagta
aacgatatcgcttcagagcatatggagattgtcacaagagatcctttctcagtcatgaca
aaaatcaaaaatgcaggagcaatctttatcggagagtactcatcagagcctttgggagac
tattttgcaggaccaaaccatgttctgcctacaaacggaacagcaaaattcttctcagcc
ttatctgtagatgactttatcaaaaagtcaagcatcatctcatattcaagagaagcactt
gagagaatacatacagatattgagcagtttgcagagtgtgagaagcttacagcacatgca
aattcaatcaaggttagatttgaggattag

DBGET integrated database retrieval system