KEGG   Cronobacter sakazakii ATCC BAA-894: ESA_04206Help
Entry
ESA_04206         CDS       T00586                                 

Definition
(GenBank) hypothetical protein
  KO
K20542  
endoglucanase [EC:3.2.1.4]
Organism
esa  Cronobacter sakazakii ATCC BAA-894
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
4163587..4164702
Genome map
AA seq 371 aa AA seqDB search
MKNLCRWLAAGLLLATVSAHAACGWADWDRFKGGYISEEGRVIDPSDPRKITTSEGQSYA
LFFALAANDREAFDNILQWTENNLAQGSLKNTLPAWLWGMKGPDEWTVLDTNSASDADLW
IAWSLLEAGRLWKEPRYSDTGKALLDRIAKEEVVNVPALGDMLLPGKVSFAEPTLWRFNP
SYMPPQLARYFTRYGKPWTTIRDTNLRLLLETAPQGFSPDWVSYEAKKGWVMKPAAPQKP
LIGSYDAIRVYLWVGMMNPADEQQAPLLKKLSPMETATIKAGVPPEKVRVIDGKTQGNGP
VGFSAALLPFLQNRDIQALQRQRVADNYPQQDAYFSYVLTLFGQGWDEHRFRFTVDGELQ
PAWGESCTSSR
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgaagaatctgtgcagatggcttgcggcggggctgctgctggcgaccgtttcagcccat
gccgcctgtggctgggctgactgggaccgctttaaaggcggctatatcagcgaagaagga
cgcgtgattgacccaagcgatccgcgcaaaatcacgacgtccgaagggcagagctacgcg
ctgttcttcgcccttgcggccaacgaccgcgaggcgttcgataacattcttcagtggacg
gaaaataaccttgcgcaaggctcgctgaaaaacacgctgcccgcctggctgtggggtatg
aaagggccggacgaatggacggtgctcgacaccaattccgcttccgacgccgatctgtgg
atagcctggagcctgcttgaagcgggacgcttgtggaaagagccgcgttacagcgacacc
ggcaaagcgctgctggaccgcatcgccaaagaagaagtggtgaacgtgcccgcgcttggc
gacatgctgctgccgggtaaagtgagctttgccgagccgacgctctggcgctttaacccg
agctatatgccgccgcagctggcgcgctatttcacccgttacggcaaaccctggacgacc
atccgcgataccaacctgcgcctgctgctggaaacggccccgcagggcttttcgccggac
tgggtgagctacgaggcgaagaaaggctgggtgatgaaacctgcggcaccgcaaaaaccg
ctgattggcagctacgacgccattcgcgtttatctgtgggtcggcatgatgaacccggcg
gatgaacagcaggcaccgctgctcaaaaaactcagcccgatggaaaccgccacaatcaaa
gcgggcgtgccgccggaaaaagttcgtgttatcgacggtaaaacccagggcaacgggccg
gtgggcttctccgccgcgctgctgccgttcctgcaaaaccgtgatatccaggcgctgcaa
cgccagcgcgtggcggacaactatccgcagcaggacgcctactttagctatgtattaacc
ctgtttggccagggatgggatgaacaccgtttccgcttcaccgttgacggtgagctgcaa
cccgcctggggagagtcatgcacaagttcgcgttaa

DBGET integrated database retrieval system