KEGG   Cronobacter sakazakii ATCC BAA-894: ESA_04206Help
Entry
ESA_04206         CDS       T00586                                 

Definition
endo-1,4-D-glucanase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
esa  Cronobacter sakazakii ATCC BAA-894
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:esa00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4163587..4164702
Genome map
AA seq 371 aa AA seqDB search
MKNLCRWLAAGLLLATVSAHAACGWADWDRFKGGYISEEGRVIDPSDPRKITTSEGQSYA
LFFALAANDREAFDNILQWTENNLAQGSLKNTLPAWLWGMKGPDEWTVLDTNSASDADLW
IAWSLLEAGRLWKEPRYSDTGKALLDRIAKEEVVNVPALGDMLLPGKVSFAEPTLWRFNP
SYMPPQLARYFTRYGKPWTTIRDTNLRLLLETAPQGFSPDWVSYEAKKGWVMKPAAPQKP
LIGSYDAIRVYLWVGMMNPADEQQAPLLKKLSPMETATIKAGVPPEKVRVIDGKTQGNGP
VGFSAALLPFLQNRDIQALQRQRVADNYPQQDAYFSYVLTLFGQGWDEHRFRFTVDGELQ
PAWGESCTSSR
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgaagaatctgtgcagatggcttgcggcggggctgctgctggcgaccgtttcagcccat
gccgcctgtggctgggctgactgggaccgctttaaaggcggctatatcagcgaagaagga
cgcgtgattgacccaagcgatccgcgcaaaatcacgacgtccgaagggcagagctacgcg
ctgttcttcgcccttgcggccaacgaccgcgaggcgttcgataacattcttcagtggacg
gaaaataaccttgcgcaaggctcgctgaaaaacacgctgcccgcctggctgtggggtatg
aaagggccggacgaatggacggtgctcgacaccaattccgcttccgacgccgatctgtgg
atagcctggagcctgcttgaagcgggacgcttgtggaaagagccgcgttacagcgacacc
ggcaaagcgctgctggaccgcatcgccaaagaagaagtggtgaacgtgcccgcgcttggc
gacatgctgctgccgggtaaagtgagctttgccgagccgacgctctggcgctttaacccg
agctatatgccgccgcagctggcgcgctatttcacccgttacggcaaaccctggacgacc
atccgcgataccaacctgcgcctgctgctggaaacggccccgcagggcttttcgccggac
tgggtgagctacgaggcgaagaaaggctgggtgatgaaacctgcggcaccgcaaaaaccg
ctgattggcagctacgacgccattcgcgtttatctgtgggtcggcatgatgaacccggcg
gatgaacagcaggcaccgctgctcaaaaaactcagcccgatggaaaccgccacaatcaaa
gcgggcgtgccgccggaaaaagttcgtgttatcgacggtaaaacccagggcaacgggccg
gtgggcttctccgccgcgctgctgccgttcctgcaaaaccgtgatatccaggcgctgcaa
cgccagcgcgtggcggacaactatccgcagcaggacgcctactttagctatgtattaacc
ctgtttggccagggatgggatgaacaccgtttccgcttcaccgttgacggtgagctgcaa
cccgcctggggagagtcatgcacaagttcgcgttaa

DBGET integrated database retrieval system