KEGG   Escherichia coli O150 H5 SE15 (commensal): ECSF_3400Help
Entry
ECSF_3400         CDS       T02077                                 

Definition
D-xylose isomerase
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
ese  Escherichia coli O150:H5 SE15 (commensal)
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:ese00040]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:ese00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3685258..3686580)
Genome map
AA seq 440 aa AA seqDB search
MQAYFDQLDRVRYEGSKSSNPLAFRHYNPDELVLGKRMEEHLRFAACYWHTFCWNGADMF
GVGAFNRPWQQPGEALALAKRKADVAFEFFHKLHVPFYCFHDVDVSPEGASLKEYINNFA
QMVDVLAGKQEESGVKLLWGTANCFTNPRYGAGAATNPDPEVFSWAATQVVTAMEATHKL
GGENYVLWGGREGYETLLNTDLRQEREQLGRFMQMVVEHKHKIGFQGTLLIEPKPQEPTK
HQYDYDAATVYGFLKQFGLEKEIKLNIEANHATLAGHSFHHEIATAIALGLFGSVDANRG
DAQLGWDTDQFPNSVEENALVMYEILKAGGFTTGGLNFDAKVRRQSTDKYDLFYGHIGAM
DTMALALKIAARMIEDGELDKRIAQRYSGWNSELGQQILKGQMSLADLAKYAQEHNLSPV
HQSGRQEQLENLVNHYLFDK
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgcaagcctattttgaccagctcgatcgcgttcgttatgaaggctcaaaatcctcaaac
ccgttagcattccgtcactacaatcccgacgaactggtgttgggcaagcgtatggaagag
cacttgcgttttgccgcctgctactggcacaccttctgctggaacggggcggatatgttt
ggtgtgggggcgtttaatcgtccgtggcagcagcctggtgaggcactggcgttggcgaag
cgtaaagcagatgtcgcatttgagtttttccacaagttacatgtgccattttattgcttc
cacgatgtggatgtttcccctgagggcgcgtcgttaaaagagtacatcaataattttgcg
caaatggttgatgtcctggcaggcaagcaagaagagagcggcgtgaagctgctgtgggga
actgctaactgctttacaaaccctcgctatggcgcgggtgcggcgacgaacccagatcct
gaagtcttcagttgggcggcaacgcaagttgttacagcgatggaagcaacccataaattg
ggcggtgaaaactatgtcctgtggggtggtcgtgaaggttacgaaacgctgttaaatacc
gacttgcgccaggagcgtgaacagctgggccgctttatgcagatggtggttgagcataaa
cataaaatcggtttccagggcacgttgcttatcgaaccgaaaccgcaagaaccgaccaaa
catcaatatgattacgatgctgcgacggtctatggcttcctgaaacagtttggtctggaa
aaagagattaaactgaacattgaagctaaccacgcgacgctggcaggtcactctttccat
catgaaatagccaccgccattgcgcttggcctgttcggttctgtcgacgccaaccgtggc
gatgcgcaactgggctgggacaccgaccagttcccgaacagtgtggaagagaatgcgctg
gtgatgtatgaaattctcaaagcaggcggtttcaccaccggtggtctgaacttcgatgcc
aaagtacgtcgtcaaagtactgataaatatgatctgttttacggtcatatcggcgcgatg
gatacgatggcgttggcgctgaaaattgcagcgcgcatgattgaagatggcgagctggat
aaacgcatcgcgcagcgttattccggctggaatagtgaattaggccagcaaatcctgaaa
ggccaaatgtcactggcagatttagccaaatatgctcaggaacataatttgtctccggtg
catcagagtggtcgccaggagcaactggaaaatctggtaaatcattatctgttcgacaaa
taa

DBGET integrated database retrieval system