KEGG   Echinicola vietnamensis: Echvi_2136Help
Entry
Echvi_2136        CDS       T02388                                 

Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
evi  Echinicola vietnamensis
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:evi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Echvi_2136
Enzymes [BR:evi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Echvi_2136
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2523138..2523836
Genome map
AA seq 232 aa AA seqDB search
MKQKGIMLNTTGIDIDRSIDEIGDEHIGTSHETPLREDAFEMDDELKMELIEKHFKDIMH
VLGLDLTDDSLKGTPRRVAKMFVQEVFSGLDPKNKPEIKLFENKYKYSEMLVEKDITFFS
HCEHHFVPIYGKAHVAYISNGNVIGLSKINRIVQYFAKRPQVQERLTMQIGNELKEILGT
DDVAVVIDAHHMCVSSRGVKDVNSKTVTSFYSGKFDKDDSTRKEFMQYVTMQ
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgaaacagaaaggaattatgttgaatacgacgggcattgatatagacaggtcaatagat
gaaatcggggacgagcatatcggcacttcccatgaaactcctttgcgagaagatgctttt
gaaatggacgatgagctcaagatggagttgatcgagaaacattttaaggacatcatgcat
gtactggggctggacctgacagatgatagccttaaaggcactccgcgtcgtgtggcgaaa
atgtttgtacaagaagtttttagcggcttggatccaaagaacaagccagagataaaactt
tttgaaaataaatataaatacagtgagatgcttgtcgagaaggatattacattcttctcc
cattgtgagcatcattttgtgcccatttatggtaaggcccatgtagcttatatttccaat
ggcaatgtcattggtctttccaagatcaatcgaatcgttcagtatttcgctaaacggccc
caagttcaggagaggcttaccatgcagataggcaatgaactgaaggaaatcctgggaacg
gatgatgtggcagtggtcattgatgcccaccacatgtgtgtgtcttccagaggtgtaaaa
gatgtcaatagtaagaccgtaacgtctttttacagtgggaaatttgacaaggatgacagc
actcgaaaggagttcatgcaatatgtgaccatgcagtaa

DBGET integrated database retrieval system