KEGG   Ficedula albicollis (collared flycatcher): 101816227Help
Entry
101816227         CDS       T02815                                 

Definition
NAD(P)(+)--arginine ADP-ribosyltransferase 2-like
Orthology
K06716  
ADP-ribosyltransferase 1 [EC:2.4.2.31]
Organism
fab  Ficedula albicollis (collared flycatcher)
Brite
Enzymes [BR:fab01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     101816227
Cellular antigens [BR:fab04090]
 Proteins
  101816227
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 278 aa AA seqDB search
MALLALTLALLPMTVATTAYEVIPLDMALDSFDDQYWGCGPAMKAALPALNRSEFQKNPL
FAKVWQKAVAEWQSWESPVSPLSSSSQAIAIMAYTMNDLYQEFNDEVRMAGRSPQAYRDN
FHFKTLHFLLTDALATLKVKEEQKCRCVYRGVDKYKFKANVGDIVRFGQFASTSVCEDVA
HDFGETTVFVVRTCYGAYIEPFSHFDDEEEVLIPPFEKFKVTEVIEEKKKVEIHLESIGT
YSKYNCEWVNGGSSHMAPCHLGGLLLATTVLAMATGIL
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atggccctcctggctctcaccctggctctgctgccaatgaccgtggccaccacggcctat
gaggtgatacccctggacatggccctggactccttcgatgaccagtactggggctgtggc
cctgccatgaaggcggcactgccggccctgaaccgctctgagtttcagaagaatcctctc
tttgccaaggtctggcaaaaggccgtggctgagtggcagagttgggagtcccctgtgtcc
cctctgtcgtcctcatcccaggccatcgccatcatggcctacaccatgaatgacctgtac
caggagttcaacgatgaagtgaggatggccgggcgctccccccaggcataccgggacaat
ttccacttcaaaactctgcatttcctgctgaccgacgccctggccacgctgaaggtcaag
gaggaacaaaaatgtcgctgtgtgtaccggggggtagacaagtacaagttcaaggcaaac
gttggcgacatcgtccggttcggtcaattcgcgtcgacgtcggtttgcgaagatgtcgcc
cacgattttggggaaaccacggtgttcgtggtgcgaacgtgttacggcgcgtacatcgag
ccattctcccactttgacgatgaggaggaggtgctgatcccaccctttgagaagttcaag
gtcaccgaagtcatcgaggagaagaagaaggtggagatccacctcgagtccatcgggacc
tacagcaaatacaactgcgagtgggtgaatggtgggagcagccacatggccccctgccac
ctcggaggactcctcctggccaccacagtcctggccatggccaccgggatcctctga

DBGET integrated database retrieval system