KEGG   Frankia alni: FRAAL0810Help
Entry
FRAAL0810         CDS       T00384                                 

Definition
(GenBank) putative guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
fal  Frankia alni
Pathway
fal00230  Purine metabolism
fal01100  Metabolic pathways
Module
fal_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:fal00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    FRAAL0810
Enzymes [BR:fal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     FRAAL0810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPT AAA_18 Zeta_toxin Guanylate_kin AAA_16
Motif
Other DBs
NCBI-ProteinID: CAJ59479
RhizoBase: FRAAL0810
UniProt: Q0RSI3
Position
882524..883111
Genome map
AA seq 195 aa AA seqDB search
MRPDAVILYGPPAAGKDTVTAALTALDDRYVHFDRLKVGANAGAPYRAASADELDRLQAE
GAILYANERYGNVYAIDRPRLDDLTTAGRVPVVHLGQVAGIHTLHAEYPARWVTVLLWCP
REVTATRARQRGSTDVAERLTVWDETKTDLAAADMDVFDVVLRTDQRPPDEAAVHIHRAL
TDRARAVPPVWDKVD
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcctgacgccgtcatcctttacggcccccccgccgcagggaaggacaccgtcacc
gccgccctcaccgcgctggacgatcggtatgtgcacttcgaccggctgaaagtcggtgcc
aacgccggtgccccctaccgggcggcatccgccgacgaacttgaccgcctccaggccgag
ggggcgattctctatgcgaacgagcggtacgggaacgtctacgccatcgaccggccccgc
ctcgacgacctcaccaccgccggccgcgtgccagtcgtgcacctcggccaggtcgccggc
atccacaccctgcatgccgaatatccagcccggtgggtgacggtcctgctttggtgcccc
cgcgaggttaccgccacccgagcccgccagcgcgggagcaccgacgttgccgaaagactg
accgtctgggacgagacgaaaaccgatctcgccgccgcggacatggacgtgttcgacgtg
gtgctacgcaccgaccagcgaccgcccgacgaggctgccgttcacatccaccgcgctctg
acggaccgggcccgagccgtcccgccggtatgggacaaggtggactga

DBGET integrated database retrieval system