KEGG   Felis catus (domestic cat): 101090478Help
Entry
101090478         CDS       T02385                                 

Gene name
USP31
Definition
ubiquitin specific peptidase 31
Orthology
K11852  
ubiquitin carboxyl-terminal hydrolase 31 [EC:3.1.2.15]
Organism
fca  Felis catus (domestic cat)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
E3
AA seq 1210 aa AA seqDB search
MAATAASAPGGRRREAGHYRAGRPEPSPDPEQPVGRGTQGQGEVTEQLAHLVRALWTLEY
TPQHSRDFKSIVSKNALQYRGNSQHDAQEFLLWLLDRVHEDLNHAVKQSGQPPLKPPSET
DMMPEGPSFPVCSTFVQELFQAQYRSSLTCPHCQKQSNTFDPFLCISLPIPLPHTRPLYV
TVVYQGKCSHCMRIGVAVPLSGTVARLREAVSMETKIPTDQIVLTEMYYDGFHRSFCDTD
DLETVHESDCIFAFETPEIFRPEGILSQRGIHLNNNLNHLKFGLDHHRLSSCTQAATKQG
KTDLPLTRPGGDKIVLLVCNRACTGQQGKRFGLPFVLHLEKTIAWDLLQKEILEKMKYFL
RPTVCIQVCPFSLRVVSVVGITYLLPQEEKPLCHPTVERALKSCGPGGTAHVKLVVEWDK
ETKDFLFVNTEDEYIPDAESVRLQRERHHQPQTCTLSQCFQLYTKEERLAPDDAWRCPHC
KQLQQGSITLSLWTLPDVLIIHLKRFRQEGDRRMKLQNMVKFPLTGLDMTPHVVKRSQSS
WSLPSHWSPWRRPYGLGRDPEDYVYDLYAVCNHHGTMQGGHYTAYCKNSVDGLWYCFDDS
DVQQLSEDEVCTQTAYILFYQRRTAIPSWSANSSVAGSTSSSLCEHWVSRLPGSKQASVT
SAASSRRTSLASLSESVEMTGERSEDDGGFSTRPFVRSVQRQSLSSRSSVTSPLAVNDNC
IRPSWSLSAKLQMRSNSPSRFSGDSPIHTSASTLEKIGEAVDDKVSISCFGSLRNLSSSF
QEPSDSHGRREHKAVGRAPLAVMEGVFRDESDTHKLNSGVLDTQSKNSAQGDCVPPISDP
FDNNNQIAYVDQSDSVDSSPVKEVKPTSHPGSLAKKPESTAKSSPSSKGASEPDRSLRKG
RPVLASQESSLSSTSPSSPVPVKVSIKPSRSRSKADSSSRASGRHSSPGPAQPRKESSPK
SQDSMSSPSPQRQKSSSSLAYTPSSASAKKAPGPAARGPFPPGKSRTSDRSLSREGSRQS
LASDRASVTSSSKPNSPRVSQARVGEGRGDGKHVRSSSMASLRSPNTSMKAGLKRDSKSE
DKGLSFFKSALRQKETRRSTDLGKTTLLSKKAGSSSAKLASKNAVDDKAEKGYQPAGSQQ
PNASAVGKEQLVSKDPASAKHSLLSARKSKSSQLDSGVPSSPGGRQSAEKSSKKLSSSMQ
TSARPSQKPQ
NT seq 3633 nt NT seq  +upstreamnt  +downstreamnt
atggcagccacagcggcttcagcgccgggcgggcggcgccgggaggcgggtcactaccgg
gcggggcggcccgagccctcgcctgaccccgagcagcctgtgggccgcggcacgcagggc
cagggcgaggtcaccgagcagctggcgcacctggtgcgggccctctggaccctggagtac
accccgcagcacagccgcgacttcaagagtattgtgtcaaagaacgcactgcagtatcgg
ggaaattcccagcatgatgcccaggagtttctgctgtggcttttggaccgagttcatgag
gacctcaatcatgctgtgaagcagagcggccagcctcctctgaagccaccatcagagact
gatatgatgcccgagggaccatcttttcctgtctgtagcacttttgtacaagaacttttt
caagcccagtacagatcttctttgacatgtcctcattgtcagaagcagagcaacactttt
gaccctttcctctgcatttctttgccaattcctctaccccacacaaggcctctctatgtt
accgtagtgtatcaggggaagtgttctcactgcatgaggattggtgttgccgtgcctctg
tctgggactgtcgccaggcttcgggaagcagtgtctatggaaacaaagatccctactgat
cagattgtgttaacggaaatgtactatgatgggttccatcgttccttttgtgacacagac
gacctggaaacagtccatgaaagcgactgcatttttgcctttgagactccagaaatattt
aggcctgaaggaattctcagtcaaagaggaatccacttaaacaacaatctaaaccacttg
aaatttggcttggatcatcatcgactgtcttcttgtacacaggcagcaacaaagcaaggg
aaaacagacttgcccctgacaagaccaggaggcgacaagattgttcttttagtgtgtaac
cgagcttgcactgggcagcaagggaaaagatttggactgccttttgtgctgcacttggag
aagacaatagcatgggaccttctgcagaaggaaatcttggagaagatgaagtatttcctg
aggcccacggtttgcattcaggtgtgtccattcagtttgcgtgtcgtcagtgttgtgggg
ataacatacttgctgccccaggaggagaaacccctgtgccacccaacggtagaaagggca
ttaaaatcttgtggaccaggtggcactgctcatgtgaagttagtggtagaatgggacaag
gaaacaaaagatttcttgtttgtaaatactgaagatgagtatattcctgatgcagaaagt
gtccgtctgcagagggagcgtcatcatcagccccagacttgcactttatcccagtgtttc
cagctctacaccaaagaggagcggcttgccccggatgacgcctggcggtgcccgcactgt
aagcagctgcagcaggggagcatcacgttaagcctctggactctgcctgatgtgcttatt
atccatctgaagagatttcgacaggaaggagacaggcgtatgaaacttcagaacatggtc
aagttccccttgactggcctggacatgacacctcatgtggttaagagaagtcagagcagc
tggagtttgccatcccattggtctccatggagacggccctatggactcgggagggaccct
gaggactacgtctatgacctgtatgctgtgtgcaatcatcatggcaccatgcaagggggg
cactacacagcctactgtaagaactctgtggacggcctctggtactgcttcgatgacagt
gacgtgcagcagctgtcagaagatgaggtctgcacacagacagcgtacatccttttctac
cagaggcggacagctattccatcatggtcagccaacagctcagtggcaggctccaccagc
tcctccttgtgtgaacactgggtgagccggctcccagggagcaagcaagccagcgtgacc
tccgcggcgtcctccagacgcacctctctggcctcattatccgagtcggtggagatgacc
ggagagaggagtgaagacgatggaggtttctcaactcgaccattcgtgagaagcgtccag
cgtcagagcttgtcatccagatcttctgtcaccagccccttggccgttaacgacaattgc
attagaccttcttggtccctgtctgctaagctgcagatgcgctccaattctccttcccgg
ttctcaggagactctccgatccacacctctgcctccaccttggagaagatcggggaggcg
gtggatgataaggtctccatctcttgctttggcagcttgaggaacctttctagcagtttc
caggaaccaagtgatagtcacggccgacgtgagcacaaggctgtgggtcgggcccctctg
gctgtcatggaaggcgtgttcagagatgaatcagacacccacaaattgaactccggtgtt
ttagacacacagagcaaaaactcagcacaaggggattgcgtgccccccatctccgatcct
tttgataataataaccagattgcttatgtggatcagagcgattctgtagacagctctcca
gtcaaagaggtgaaacccacgagccacccaggctcccttgcaaagaaaccagagagcaca
gccaagagctctcccagctccaaaggcgcttctgagccagatagaagcttgcggaagggg
agaccagtcttggcaagccaggaatcatctctttcaagtacgtccccttcttctcctgtt
cctgtaaaagtttctataaagccctcccgctcccgaagcaaagcagattcttcttccaga
gccagtggacggcattcctctcctggccctgcccagcctagaaaggagtcctcccccaaa
tcccaagactccatgtcatctccttcaccccagaggcagaagtcctcttcctccctcgcc
tacactccttcctccgcatctgccaaaaaagcccccggccctgctgcaaggggccccttc
cctcctgggaagagcaggacttcagacaggagcttgagtagagagggctccagacagagc
ctggcttccgacagagccagcgtcacctccagctccaaacccaactcccctcgggtgagc
caagccagggtgggggagggccgaggagacggaaagcacgtcaggagctcctctatggcc
agtctgcgctcccccaacacaagcatgaaggctggtctgaagagggacagcaagtcagag
gacaaggggctatccttcttcaagtcggccttgagacagaaggaaacccggcggtcaact
gaccttggcaaaacaaccttgctctccaagaaggctggcagtagctctgccaagttggcc
agtaagaatgccgtggatgacaaggcagagaaaggctatcagcctgcaggttcccagcag
ccaaatgcaagtgcagttggaaaagagcagcttgtctccaaggaccctgcttccgctaaa
cattccctgctgtccgctcgcaaatccaagtcttcccagctagattctggagtgccctca
tctcctggtggcaggcagtctgctgagaaatcctcgaaaaagttatcttctagcatgcaa
acctctgcacggccttctcaaaaacctcagtga

DBGET integrated database retrieval system