KEGG   Felis catus (domestic cat): 101091211Help
Entry
101091211         CDS       T02385                                 

Gene name
ADCY6
Definition
(RefSeq) adenylate cyclase type 6 isoform X2
  KO
K08046  adenylate cyclase 6 [EC:4.6.1.1]
Organism
fca  Felis catus (domestic cat)
Pathway
fca00230  Purine metabolism
fca01522  Endocrine resistance
fca04015  Rap1 signaling pathway
fca04022  cGMP-PKG signaling pathway
fca04024  cAMP signaling pathway
fca04062  Chemokine signaling pathway
fca04072  Phospholipase D signaling pathway
fca04114  Oocyte meiosis
fca04211  Longevity regulating pathway
fca04213  Longevity regulating pathway - multiple species
fca04261  Adrenergic signaling in cardiomyocytes
fca04270  Vascular smooth muscle contraction
fca04371  Apelin signaling pathway
fca04540  Gap junction
fca04611  Platelet activation
fca04713  Circadian entrainment
fca04714  Thermogenesis
fca04723  Retrograde endocannabinoid signaling
fca04724  Glutamatergic synapse
fca04725  Cholinergic synapse
fca04727  GABAergic synapse
fca04742  Taste transduction
fca04750  Inflammatory mediator regulation of TRP channels
fca04911  Insulin secretion
fca04912  GnRH signaling pathway
fca04913  Ovarian steroidogenesis
fca04914  Progesterone-mediated oocyte maturation
fca04915  Estrogen signaling pathway
fca04916  Melanogenesis
fca04918  Thyroid hormone synthesis
fca04921  Oxytocin signaling pathway
fca04923  Regulation of lipolysis in adipocytes
fca04924  Renin secretion
fca04925  Aldosterone synthesis and secretion
fca04926  Relaxin signaling pathway
fca04927  Cortisol synthesis and secretion
fca04928  Parathyroid hormone synthesis, secretion and action
fca04934  Cushing's syndrome
fca04961  Endocrine and other factor-regulated calcium reabsorption
fca04962  Vasopressin-regulated water reabsorption
fca04970  Salivary secretion
fca04971  Gastric acid secretion
fca04972  Pancreatic secretion
fca04976  Bile secretion
fca05032  Morphine addiction
fca05166  HTLV-I infection
fca05200  Pathways in cancer
fca05414  Dilated cardiomyopathy (DCM)
Module
fca_M00695  cAMP signaling
Brite
KEGG Orthology (KO) [BR:fca00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    101091211 (ADCY6)
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    101091211 (ADCY6)
   04371 Apelin signaling pathway
    101091211 (ADCY6)
   04072 Phospholipase D signaling pathway
    101091211 (ADCY6)
   04024 cAMP signaling pathway
    101091211 (ADCY6)
   04022 cGMP - PKG signaling pathway
    101091211 (ADCY6)
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    101091211 (ADCY6)
  Cellular community - eukaryotes
   04540 Gap junction
    101091211 (ADCY6)
 Organismal Systems
  Immune system
   04611 Platelet activation
    101091211 (ADCY6)
   04062 Chemokine signaling pathway
    101091211 (ADCY6)
  Endocrine system
   04911 Insulin secretion
    101091211 (ADCY6)
   04923 Regulation of lipolysis in adipocyte
    101091211 (ADCY6)
   04912 GnRH signaling pathway
    101091211 (ADCY6)
   04913 Ovarian Steroidogenesis
    101091211 (ADCY6)
   04915 Estrogen signaling pathway
    101091211 (ADCY6)
   04914 Progesterone-mediated oocyte maturation
    101091211 (ADCY6)
   04921 Oxytocin signaling pathway
    101091211 (ADCY6)
   04926 Relaxin signaling pathway
    101091211 (ADCY6)
   04918 Thyroid hormone synthesis
    101091211 (ADCY6)
   04928 Parathyroid hormone synthesis, secretion and action
    101091211 (ADCY6)
   04916 Melanogenesis
    101091211 (ADCY6)
   04924 Renin secretion
    101091211 (ADCY6)
   04925 Aldosterone synthesis and secretion
    101091211 (ADCY6)
   04927 Cortisol synthesis and secretion
    101091211 (ADCY6)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101091211 (ADCY6)
   04270 Vascular smooth muscle contraction
    101091211 (ADCY6)
  Digestive system
   04970 Salivary secretion
    101091211 (ADCY6)
   04971 Gastric acid secretion
    101091211 (ADCY6)
   04972 Pancreatic secretion
    101091211 (ADCY6)
   04976 Bile secretion
    101091211 (ADCY6)
  Excretory system
   04962 Vasopressin-regulated water reabsorption
    101091211 (ADCY6)
   04961 Endocrine and other factor-regulated calcium reabsorption
    101091211 (ADCY6)
  Nervous system
   04724 Glutamatergic synapse
    101091211 (ADCY6)
   04727 GABAergic synapse
    101091211 (ADCY6)
   04725 Cholinergic synapse
    101091211 (ADCY6)
   04723 Retrograde endocannabinoid signaling
    101091211 (ADCY6)
  Sensory system
   04742 Taste transduction
    101091211 (ADCY6)
   04750 Inflammatory mediator regulation of TRP channels
    101091211 (ADCY6)
  Aging
   04211 Longevity regulating pathway - mammal
    101091211 (ADCY6)
   04213 Longevity regulating pathway - multiple species
    101091211 (ADCY6)
  Environmental adaptation
   04713 Circadian entrainment
    101091211 (ADCY6)
   04714 Thermogenesis
    101091211 (ADCY6)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    101091211 (ADCY6)
  Substance dependence
   05032 Morphine addiction
    101091211 (ADCY6)
  Cardiovascular diseases
   05414 Dilated cardiomyopathy (DCM)
    101091211 (ADCY6)
  Endocrine and metabolic diseases
   04934 Cushing's syndrome
    101091211 (ADCY6)
  Infectious diseases
   05166 HTLV-I infection
    101091211 (ADCY6)
  Drug resistance
   01522 Endocrine resistance
    101091211 (ADCY6)
Enzymes [BR:fca01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     101091211 (ADCY6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc AC_N DUF1053 HNOBA Shisa
Motif
Other DBs
NCBI-GeneID: 101091211
NCBI-ProteinID: XP_006933719
Ensembl: ENSFCAG00000000079
Position
B4
AA seq 1262 aa AA seqDB search
MCWCGACPGAREWTFQFLPDLLCLLTQALELVTTKKSVLFREEVNVEVYCFGVRQIWVRI
LVPTHPWLLDVGRVTRLLLSRFPHLLNGDPVVLLHTFIMSWFSGLLVPKVDERKTAWGER
NGQKRPRRGTRTSGFCTPRYMSCLRDAQPPSPTPAAPPRCPWQDETFMRRGGPGKEPGLR
AVALGFEDTEAMAAVGAAEVAPDVAARGRRSCWRRLAQVFQSKQFRSAKLERLYQRYFFQ
MNQSSLTLLMAVLVLLTAVLLAFHAAPARPQPAYVALLACAAALFVALMVVCNRHSFRQD
SMWVVSYVVLGILAAVQVGGALAANPRSPSVGLWCPVFFVYITYTLLPIRMRAAVFSGLG
LSTLHLILAWQLNHGDAFLWKQLGANMLLFLCTNVIGICTHYPAEVSQRQAFQETRGYIQ
ARLHLQHENRQQERLLLSVLPQHVAMEMKEDINTKKEDMMFHKIYIQKHDNVSILFADIE
GFTSLASQCTAQELVMTLNELFARFDKLAAENHCLRIKILGDCYYCVSGLPEARADHAHC
CVEMGVDMIEAISLVREVTGVNVNMRVGIHSGRVHCGVLGLRKWQFDVWSNDVTLANHME
AGGRAGRIHITRATLQYLNGDYEVEPGRGGERNAYLKEQHIETFLILGASQKRKEEKAML
AKLQRTRANSMEGLMPRWVPERAFSRTKDSKAFRQMGIDDSSKDNRGAQDALNPEDEVDE
FLGRAIDARSIDQLRKDHVRRFLLTFQREDLEKKYSRKVDPRFGAYVACALLVFCFICFI
QLLVFPHSTLLLGIYASIFLLLLITVLTCAVYSCGSLFPKALQRLSRSIVRSRAHSTAVG
IFSVLLVFTSAIANMFTCNHTPIRTCAARMLNVTPADITACHLQQLNYSLGLDAPLCEGT
APTCSFPEYFVGNMLLSLLASSVFLHISSIGKLAMIFVLGLIYLVLLLLGPPATIFDNYD
LLLGVHGLASSNETFDGLDCPAAGRVALKYMTPVILLVFALALYLHAQQVESTARLDFLW
KLQATGEKEEMEELQAYNRRLLHNILPKDVAAHFLARERRNDELYYQSCECVAVMFASIA
NFSEFYVELEANNEGVECLRLLNEIIADFDEIISEERFRQLEKIKTIGSTYMAASGLNAS
TYDQAGRSHITALADYAMRLMEQMKHINEHSFNNFQMKIGLNMGPVVAGVIGARKPQYDI
WGNTVNVSSRMDSTGVPDRIQVTTDLYQVLAAKGYQLECRGVVKVKGKGEMTTYFLNGGP
PS
NT seq 3789 nt NT seq  +upstreamnt  +downstreamnt
atgtgctggtgtggtgcctgccccggtgctcgggagtggacttttcagttcctcccagac
ctcctttgcttattgacacaggcactcgagcttgtaaccaccaagaaatcagtgcttttt
agggaagaggtgaatgttgaagtgtactgctttggagtccggcagatctgggttagaatc
ttggttcccacacatccgtggctgcttgatgtagggcgagttacccgcctgcttctgtct
cggtttcctcacctgctgaatggggatcccgtcgtcctcctccatacttttatcatgtcc
tggtttagtggcctcctggtccccaaggtggatgaacggaaaacagcctggggtgaacgc
aatgggcagaagcgtccacgccgtgggactcggaccagcggcttctgcacaccgcgctat
atgagctgcctccgggatgcacagccccccagccccacccctgcagctcctcctcggtgc
ccctggcaggatgagactttcatgcggagaggtggcccgggcaaggagccggggctgcgg
gcggtggccctcggctttgaggacactgaggcgatggcggcggtcggggcagccgaggtg
gcacccgacgtggcagcccggggtaggcggtcttgctggcgccgtctggcccaggtgttc
cagtccaagcagttccgctcggccaagctggagcgcctgtaccagcggtacttctttcag
atgaaccagagcagcctgacgctgctgatggccgtgctggtgctgctgacggccgtgctg
ctagcctttcatgctgcacctgcccgccctcagcctgcctatgtggccctactggcctgt
gccgccgccctcttcgtagcgctcatggtggtgtgtaaccggcacagcttccgccaggac
tccatgtgggtggtgagctatgtggtgctgggcatcctggcagccgtgcaggttgggggt
gccctggcagccaacccccgcagcccctctgtgggcctctggtgccccgtgttttttgtc
tacatcacctacacgctcctacccatccgcatgcgggcggctgtcttcagtggcctgggc
ctctccaccctgcatctgatcttggcctggcagctcaaccatggtgatgccttcctctgg
aagcagcttggtgccaacatgctgctgttcctctgcaccaacgtcattggcatctgcaca
cactatccagctgaggtgtctcagcgccaggcctttcaggagacccgtggttacatccag
gcccggctgcacctgcagcatgagaatcggcagcaggaacggctgctgctatcagtgttg
ccccagcacgttgccatggagatgaaagaagatatcaacacaaagaaagaagacatgatg
ttccacaagatctacatacagaagcatgacaatgtcagcatcctgtttgcagacattgaa
ggcttcaccagcctggcatcccagtgcactgcgcaggagctggtcatgaccctgaacgag
ctctttgcccggtttgacaaactggctgcggaaaatcattgcctgaggatcaagatctta
ggggactgttactactgtgtgtcggggctgccggaagcccgagcagaccatgcccactgc
tgtgtggagatgggggtggacatgatcgaggccatctcgctggtgcgtgaggtgacaggt
gtgaacgtgaacatgcgcgtgggcatccacagcgggcgtgtgcactgtggcgtccttggt
ctgcggaaatggcaattcgatgtgtggtccaatgacgtgactctggccaaccacatggag
gcggggggccgggccggccgcatccatatcactcgggccacactgcagtacctgaatggg
gattatgaggtggagccaggccgtggtggtgagcgtaatgcatacctcaaggagcagcat
attgagaccttcctcatcctgggagccagccagaaacggaaagaggagaaggccatgctg
gccaagctgcagcgtacacgggccaactccatggaaggactgatgccacgctgggtgcct
gagcgcgccttttcccggaccaaggactccaaggctttccgccagatgggcattgatgat
tccagcaaagacaaccggggtgcccaagatgccctgaaccctgaggatgaggtagatgag
ttcctgggccgtgccatcgatgcccgcagcatcgatcaactacggaaggaccatgtgcgc
cgcttcctgctcaccttccagagagaggatcttgaaaagaagtactcgcggaaggtggac
ccccgcttcggagcctacgtagcctgtgcgctgttggtcttctgcttcatctgctttatc
caactcctcgtcttcccacattcaactctgcttcttgggatctatgccagtatcttcctg
ctgttgctgatcactgtgctgacctgtgccgtgtactcctgtggctctctcttccccaag
gccctgcaacgcctttcccgcagcattgtccgttctcgggcacacagcactgcggttggc
atcttttcagtcttgcttgtgttcacctctgccatcgccaacatgttcacctgtaaccac
acccccatacggacttgtgcagcccggatgctgaatgtaacacctgctgacatcactgcc
tgccacctgcagcagctcaattactctctgggcctggatgctcccctgtgtgagggcacc
gcacccacttgcagcttccctgagtacttcgttgggaacatgctgctgagtctcttggcc
agctctgtcttcctacacatcagtagcatcgggaagttggcaatgatctttgtcctcggg
ctcatctatttggtgctgcttctgctgggccccccagccaccatctttgacaactatgac
ctgctgcttggtgtccatggcttggcttcttccaatgagactttcgacgggctggactgc
ccagctgcagggagggtagcactcaaatacatgacccccgtgattctgctggtgtttgct
ctggcgctgtatctgcatgcccagcaggtggaatcaactgctcgtctggacttcctctgg
aaactgcaggcaacaggggagaaggaggagatggaggagctgcaggcatacaaccgaagg
ctgctccataacattctgcccaaggacgtggctgcccacttcctggcccgggagcgccgg
aacgatgagctctactatcagtcgtgtgagtgtgtggccgtcatgtttgcctccattgcc
aacttttctgagttctatgtggagctggaggcaaacaatgagggcgtcgagtgcctgcgg
ctgctcaacgaaatcatcgctgactttgatgagatcatcagcgaggagcggttccggcag
ctggagaagatcaagacgattggtagcacctacatggctgcctcagggctgaatgccagc
acctatgatcaagcgggccgctcccatatcactgccctggctgactatgccatgcggctc
atggaacagatgaagcacatcaacgagcactccttcaacaatttccagatgaagattggg
ctgaacatgggcccagtcgtggcaggcgtcattggggctcggaaaccacagtatgacatc
tgggggaacacagtgaatgtctctagccgtatggacagcacgggggtccctgaccgaatc
caggtgaccacggacttgtaccaggttctagctgccaagggctaccagctggagtgtcga
ggggtggtcaaggtgaagggcaagggggagatgaccacctacttcctcaatgggggcccc
cccagttag

DBGET integrated database retrieval system