KEGG   Felis catus (domestic cat): 101091211Help
Entry
101091211         CDS       T02385                                 

Gene name
ADCY6
Definition
adenylate cyclase 6
Orthology
K08046  
adenylate cyclase 6 [EC:4.6.1.1]
Organism
fca  Felis catus (domestic cat)
Pathway
Purine metabolism
Rap1 signaling pathway
cGMP-PKG signaling pathway
cAMP signaling pathway
Chemokine signaling pathway
Oocyte meiosis
Adrenergic signaling in cardiomyocytes
Vascular smooth muscle contraction
Gap junction
Platelet activation
Circadian entrainment
Retrograde endocannabinoid signaling
Glutamatergic synapse
Cholinergic synapse
GABAergic synapse
Taste transduction
Inflammatory mediator regulation of TRP channels
Insulin secretion
GnRH signaling pathway
Ovarian steroidogenesis
Progesterone-mediated oocyte maturation
Estrogen signaling pathway
Melanogenesis
Thyroid hormone synthesis
Oxytocin signaling pathway
Endocrine and other factor-regulated calcium reabsorption
Vasopressin-regulated water reabsorption
Salivary secretion
Gastric acid secretion
Pancreatic secretion
Bile secretion
Morphine addiction
HTLV-I infection
Pathways in cancer
Dilated cardiomyopathy
Module
cAMP signaling
Brite
KEGG Orthology (KO) [BR:fca00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    101091211 (ADCY6)
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    101091211 (ADCY6)
   04024 cAMP signaling pathway
    101091211 (ADCY6)
   04022 cGMP - PKG signaling pathway
    101091211 (ADCY6)
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    101091211 (ADCY6)
  Cellular commiunity
   04540 Gap junction
    101091211 (ADCY6)
 Organismal Systems
  Immune system
   04611 Platelet activation
    101091211 (ADCY6)
   04062 Chemokine signaling pathway
    101091211 (ADCY6)
  Endocrine system
   04911 Insulin secretion
    101091211 (ADCY6)
   04912 GnRH signaling pathway
    101091211 (ADCY6)
   04913 Ovarian Steroidogenesis
    101091211 (ADCY6)
   04915 Estrogen signaling pathway
    101091211 (ADCY6)
   04914 Progesterone-mediated oocyte maturation
    101091211 (ADCY6)
   04921 Oxytocin signaling pathway
    101091211 (ADCY6)
   04918 Thyroid hormone synthesis
    101091211 (ADCY6)
   04916 Melanogenesis
    101091211 (ADCY6)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101091211 (ADCY6)
   04270 Vascular smooth muscle contraction
    101091211 (ADCY6)
  Digestive system
   04970 Salivary secretion
    101091211 (ADCY6)
   04971 Gastric acid secretion
    101091211 (ADCY6)
   04972 Pancreatic secretion
    101091211 (ADCY6)
   04976 Bile secretion
    101091211 (ADCY6)
  Excretory system
   04962 Vasopressin-regulated water reabsorption
    101091211 (ADCY6)
   04961 Endocrine and other factor-regulated calcium reabsorption
    101091211 (ADCY6)
  Nervous system
   04724 Glutamatergic synapse
    101091211 (ADCY6)
   04727 GABAergic synapse
    101091211 (ADCY6)
   04725 Cholinergic synapse
    101091211 (ADCY6)
   04723 Retrograde endocannabinoid signaling
    101091211 (ADCY6)
  Sensory system
   04742 Taste transduction
    101091211 (ADCY6)
   04750 Inflammatory mediator regulation of TRP channels
    101091211 (ADCY6)
  Environmental adaptation
   04713 Circadian entrainment
    101091211 (ADCY6)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    101091211 (ADCY6)
  Substance dependence
   05032 Morphine addiction
    101091211 (ADCY6)
  Cardiovascular diseases
   05414 Dilated cardiomyopathy (DCM)
    101091211 (ADCY6)
  Infectious diseases
   05166 HTLV-I infection
    101091211 (ADCY6)
Enzymes [BR:fca01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     101091211 (ADCY6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
B4
AA seq 1263 aa AA seqDB search
MCWCGACPGAREWTFQFLPDLLCLLTQALELVTTKKSVLFREEVNVEVYCFGVRQIWVRI
LVPTHPWLLDVGRVTRLLLSRFPHLLNGDPVVLLHTFISMSWFSGLLVPKVDERKTAWGE
RNGQKRPRRGTRTSGFCTPRYMSCLRDAQPPSPTPAAPPRCPWQDETFMRRGGPGKEPGL
RAVALGFEDTEAMAAVGAAEVAPDVAARGRRSCWRRLAQVFQSKQFRSAKLERLYQRYFF
QMNQSSLTLLMAVLVLLTAVLLAFHAAPARPQPAYVALLACAAALFVALMVVCNRHSFRQ
DSMWVVSYVVLGILAAVQVGGALAANPRSPSVGLWCPVFFVYITYTLLPIRMRAAVFSGL
GLSTLHLILAWQLNHGDAFLWKQLGANMLLFLCTNVIGICTHYPAEVSQRQAFQETRGYI
QARLHLQHENRQQERLLLSVLPQHVAMEMKEDINTKKEDMMFHKIYIQKHDNVSILFADI
EGFTSLASQCTAQELVMTLNELFARFDKLAAENHCLRIKILGDCYYCVSGLPEARADHAH
CCVEMGVDMIEAISLVREVTGVNVNMRVGIHSGRVHCGVLGLRKWQFDVWSNDVTLANHM
EAGGRAGRIHITRATLQYLNGDYEVEPGRGGERNAYLKEQHIETFLILGASQKRKEEKAM
LAKLQRTRANSMEGLMPRWVPERAFSRTKDSKAFRQMGIDDSSKDNRGAQDALNPEDEVD
EFLGRAIDARSIDQLRKDHVRRFLLTFQREDLEKKYSRKVDPRFGAYVACALLVFCFICF
IQLLVFPHSTLLLGIYASIFLLLLITVLTCAVYSCGSLFPKALQRLSRSIVRSRAHSTAV
GIFSVLLVFTSAIANMFTCNHTPIRTCAARMLNVTPADITACHLQQLNYSLGLDAPLCEG
TAPTCSFPEYFVGNMLLSLLASSVFLHISSIGKLAMIFVLGLIYLVLLLLGPPATIFDNY
DLLLGVHGLASSNETFDGLDCPAAGRVALKYMTPVILLVFALALYLHAQQVESTARLDFL
WKLQATGEKEEMEELQAYNRRLLHNILPKDVAAHFLARERRNDELYYQSCECVAVMFASI
ANFSEFYVELEANNEGVECLRLLNEIIADFDEIISEERFRQLEKIKTIGSTYMAASGLNA
STYDQAGRSHITALADYAMRLMEQMKHINEHSFNNFQMKIGLNMGPVVAGVIGARKPQYD
IWGNTVNVSSRMDSTGVPDRIQVTTDLYQVLAAKGYQLECRGVVKVKGKGEMTTYFLNGG
PPS
NT seq 3792 nt NT seq  +upstreamnt  +downstreamnt
atgtgctggtgtggtgcctgccccggtgctcgggagtggacttttcagttcctcccagac
ctcctttgcttattgacacaggcactcgagcttgtaaccaccaagaaatcagtgcttttt
agggaagaggtgaatgttgaagtgtactgctttggagtccggcagatctgggttagaatc
ttggttcccacacatccgtggctgcttgatgtagggcgagttacccgcctgcttctgtct
cggtttcctcacctgctgaatggggatcccgtcgtcctcctccatacttttatcagcatg
tcctggtttagtggcctcctggtccccaaggtggatgaacggaaaacagcctggggtgaa
cgcaatgggcagaagcgtccacgccgtgggactcggaccagcggcttctgcacaccgcgc
tatatgagctgcctccgggatgcacagccccccagccccacccctgcagctcctcctcgg
tgcccctggcaggatgagactttcatgcggagaggtggcccgggcaaggagccggggctg
cgggcggtggccctcggctttgaggacactgaggcgatggcggcggtcggggcagccgag
gtggcacccgacgtggcagcccggggtaggcggtcttgctggcgccgtctggcccaggtg
ttccagtccaagcagttccgctcggccaagctggagcgcctgtaccagcggtacttcttt
cagatgaaccagagcagcctgacgctgctgatggccgtgctggtgctgctgacggccgtg
ctgctagcctttcatgctgcacctgcccgccctcagcctgcctatgtggccctactggcc
tgtgccgccgccctcttcgtagcgctcatggtggtgtgtaaccggcacagcttccgccag
gactccatgtgggtggtgagctatgtggtgctgggcatcctggcagccgtgcaggttggg
ggtgccctggcagccaacccccgcagcccctctgtgggcctctggtgccccgtgtttttt
gtctacatcacctacacgctcctacccatccgcatgcgggcggctgtcttcagtggcctg
ggcctctccaccctgcatctgatcttggcctggcagctcaaccatggtgatgccttcctc
tggaagcagcttggtgccaacatgctgctgttcctctgcaccaacgtcattggcatctgc
acacactatccagctgaggtgtctcagcgccaggcctttcaggagacccgtggttacatc
caggcccggctgcacctgcagcatgagaatcggcagcaggaacggctgctgctatcagtg
ttgccccagcacgttgccatggagatgaaagaagatatcaacacaaagaaagaagacatg
atgttccacaagatctacatacagaagcatgacaatgtcagcatcctgtttgcagacatt
gaaggcttcaccagcctggcatcccagtgcactgcgcaggagctggtcatgaccctgaac
gagctctttgcccggtttgacaaactggctgcggaaaatcattgcctgaggatcaagatc
ttaggggactgttactactgtgtgtcggggctgccggaagcccgagcagaccatgcccac
tgctgtgtggagatgggggtggacatgatcgaggccatctcgctggtgcgtgaggtgaca
ggtgtgaacgtgaacatgcgcgtgggcatccacagcgggcgtgtgcactgtggcgtcctt
ggtctgcggaaatggcaattcgatgtgtggtccaatgacgtgactctggccaaccacatg
gaggcggggggccgggccggccgcatccatatcactcgggccacactgcagtacctgaat
ggggattatgaggtggagccaggccgtggtggtgagcgtaatgcatacctcaaggagcag
catattgagaccttcctcatcctgggagccagccagaaacggaaagaggagaaggccatg
ctggccaagctgcagcgtacacgggccaactccatggaaggactgatgccacgctgggtg
cctgagcgcgccttttcccggaccaaggactccaaggctttccgccagatgggcattgat
gattccagcaaagacaaccggggtgcccaagatgccctgaaccctgaggatgaggtagat
gagttcctgggccgtgccatcgatgcccgcagcatcgatcaactacggaaggaccatgtg
cgccgcttcctgctcaccttccagagagaggatcttgaaaagaagtactcgcggaaggtg
gacccccgcttcggagcctacgtagcctgtgcgctgttggtcttctgcttcatctgcttt
atccaactcctcgtcttcccacattcaactctgcttcttgggatctatgccagtatcttc
ctgctgttgctgatcactgtgctgacctgtgccgtgtactcctgtggctctctcttcccc
aaggccctgcaacgcctttcccgcagcattgtccgttctcgggcacacagcactgcggtt
ggcatcttttcagtcttgcttgtgttcacctctgccatcgccaacatgttcacctgtaac
cacacccccatacggacttgtgcagcccggatgctgaatgtaacacctgctgacatcact
gcctgccacctgcagcagctcaattactctctgggcctggatgctcccctgtgtgagggc
accgcacccacttgcagcttccctgagtacttcgttgggaacatgctgctgagtctcttg
gccagctctgtcttcctacacatcagtagcatcgggaagttggcaatgatctttgtcctc
gggctcatctatttggtgctgcttctgctgggccccccagccaccatctttgacaactat
gacctgctgcttggtgtccatggcttggcttcttccaatgagactttcgacgggctggac
tgcccagctgcagggagggtagcactcaaatacatgacccccgtgattctgctggtgttt
gctctggcgctgtatctgcatgcccagcaggtggaatcaactgctcgtctggacttcctc
tggaaactgcaggcaacaggggagaaggaggagatggaggagctgcaggcatacaaccga
aggctgctccataacattctgcccaaggacgtggctgcccacttcctggcccgggagcgc
cggaacgatgagctctactatcagtcgtgtgagtgtgtggccgtcatgtttgcctccatt
gccaacttttctgagttctatgtggagctggaggcaaacaatgagggcgtcgagtgcctg
cggctgctcaacgaaatcatcgctgactttgatgagatcatcagcgaggagcggttccgg
cagctggagaagatcaagacgattggtagcacctacatggctgcctcagggctgaatgcc
agcacctatgatcaagcgggccgctcccatatcactgccctggctgactatgccatgcgg
ctcatggaacagatgaagcacatcaacgagcactccttcaacaatttccagatgaagatt
gggctgaacatgggcccagtcgtggcaggcgtcattggggctcggaaaccacagtatgac
atctgggggaacacagtgaatgtctctagccgtatggacagcacgggggtccctgaccga
atccaggtgaccacggacttgtaccaggttctagctgccaagggctaccagctggagtgt
cgaggggtggtcaaggtgaagggcaagggggagatgaccacctacttcctcaatgggggc
ccccccagttag

DBGET integrated database retrieval system