KEGG   Felis catus (domestic cat): 101099586Help
Entry
101099586         CDS       T02385                                 

Gene name
KAT5
Definition
K(lysine) acetyltransferase 5
Orthology
K11304  
histone acetyltransferase HTATIP [EC:2.3.1.48]
Organism
fca  Felis catus (domestic cat)
Pathway
HTLV-I infection
Class
Human Diseases; Infectious diseases; HTLV-I infection [PATH:fca05166]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
D1
AA seq 513 aa AA seqDB search
MAEVGEIIEGCRLPVLRRNQDNEDEWPLAEILSVKDISGRKLFYVHYIDFNKRLDEWVTH
ERLDLKKIQFPKKEAKTPTKNGLPGSRPGSPEREVPASAQASGKTLPIPVQITLRFNLPK
EREAIPGGEPDQPLSSSSCLQPNHRSTKRKVEVVSPATPVPSETAPASVFPQNGSARRAV
AAQPGRKRKSNCLGTDEDSQDSSDGIPSAPRMTGSLVSDRSHDDIVTRMKNIECIELGRH
RLKPWYFSPYPQELTTLPVLYLCEFCLKYGRSLKCLQRHLTKCDLRHPPGNEIYRKGTIS
FFEIDGRKNKSYSQNLCLLAKCFLDHKTLYYDTDPFLFYVMTEYDCKGFHIVGYFSKEKE
STEDYNVACILTLPPYQRRGYGKLLIEFSYELSKVEGKTGTPEKPLSDLGLLSYRSYWSQ
TILEILMGLKSESGERPQITINEISEITSIKKEDVISTLQYLNLINYYKGQYILTLSEDI
VDGHERAMLKRLLRIDSKCLHFTPKDWSKRGKW
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atggcggaggtgggggagataatcgagggctgccgcctgcccgtgcttcggcggaaccag
gacaacgaagatgagtggcccttggccgagatcctgagtgtgaaggacatcagtggccgc
aagcttttctacgttcattatattgacttcaacaaacgcctggatgaatgggtgacccac
gagcggctggacctaaagaagatccagttccccaagaaagaggccaagacccccaccaag
aacggacttcctgggtcccgccccggctctccagagagagaggtgccggcctccgcccag
gccagcgggaagaccttgccaatcccggtccagatcacactccgcttcaacctgcccaag
gagcgggaggccattcccggtggcgagcctgaccagccgctctcctccagctcctgcctg
cagcccaaccaccgctcaacgaaacggaaggtggaggtggtttcaccagcaactccagtg
cccagcgagaccgcgccagcctcagtttttcctcagaatggatccgcccgtagggcagtg
gcagctcagccaggacggaagcgaaaatcaaattgcttgggcactgatgaggactcccag
gacagctcagatggaataccgtcggctccacgcatgactggcagcttggtgtctgaccgc
agccacgacgacatcgttacccggatgaagaacatcgagtgcatcgagctgggccggcac
cgcctgaagccgtggtacttctccccgtacccacaggagcttaccacattgcccgtcctc
tacctctgcgagttctgcctcaaatacggccgtagcctgaagtgtctgcagcgtcacttg
accaagtgtgacctgcgacatcctccgggcaatgagatttaccgcaagggcaccatctct
ttctttgagattgatggacgtaagaacaagagttattcccagaacctgtgtctcctggcc
aagtgtttcctcgaccataagacattgtactatgacacagatcccttcctcttctacgtc
atgacggagtatgactgtaagggcttccacatcgtgggctacttctccaaggaaaaggaa
tccacggaagactacaacgtggcctgcatcctgaccctgcctccctaccagcgccggggc
tacggcaagctgctgatcgagttcagctatgaactctccaaagtggaagggaaaacaggg
acccctgagaagcccctctcagaccttggcctcctatcctaccggagctactggtcccag
accatcctggagatcctgatggggctgaagtcagagagtggggagaggccgcagatcacc
atcaacgagatcagtgaaatcaccagcatcaagaaggaggatgtcatctccactctacag
tacctcaacctcatcaattactacaagggccagtatatcctcacactgtcggaggacatc
gtcgatgggcatgaacgagctatgctcaagcgtctccttcggatcgactccaagtgtctg
cacttcactcccaaggactggagcaagaggggaaagtggtga

DBGET integrated database retrieval system