KEGG   Felis catus (domestic cat): 751100Help
Entry
751100            CDS       T02385                                 

Gene name
TYR
Definition
tyrosinase (oculocutaneous albinism IA)
Orthology
K00505  
tyrosinase [EC:1.14.18.1]
Organism
fca  Felis catus (domestic cat)
Pathway
Tyrosine metabolism
Riboflavin metabolism
Metabolic pathways
Melanogenesis
Module
Catecholamine biosynthesis, tyrosine => dopamine => noradrenaline => adrenaline
Brite
KEGG Orthology (KO) [BR:fca00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    751100 (TYR)
  Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    751100 (TYR)
 Organismal Systems
  Endocrine system
   04916 Melanogenesis
    751100 (TYR)
Enzymes [BR:fca01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.18  With another compound as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.18.1  tyrosinase
     751100 (TYR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
D1
AA seq 530 aa AA seqDB search
MLLAALCCLLWSFRTSAGHFPRACASSKSLMEKECCPAWTGDSSPCGQLSGRGACQDITL
SKAPLGPQYPFTGMDDREAWPSVFYNRTCQCFGNFMGFNCGNCKFGFWGPNCTEKRLLVR
RNIFDLSVPEKNKFLAYLTLAKHTISPDYVIPIGTYGQMNNGSTPMFNDINVYDLFVWMH
YYVSRDTLLGGSEIWKDIDFAHEAPGFLPWHRLFLLLWEQEIQKLTGDENFTIPYWDWRD
AKSCDICTDEYMGGHNPANPNLLSPASFFSSWQIICTRLEEYNSRQALCDGTPEGPLLRN
PGNHDKARTPRLPSSADVEFCLSLTQYESDSMDKAANFSFRNTLEGFASPLTGIADASQS
SMHNALHIYMNGTMSQVQGSANDPIFLLHHAFVDSIFEQWLRRHHPLQEVYPEANAPIGH
NRESYMVPFIPLYRNGDFFISSRDLGYDYSNLQDSERDIFQDYIKPFLEQASRIWPWLIG
AAVVGSVLTAVLGRLTSLLCRRKRKQLREERQPLLMEKEDYHSLLYQTHV
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgctcctggctgctctgtgctgcctgctgtggagtttccggacctccgctggccatttc
cctcgagcctgtgcctcctccaagagcctgatggagaaggaatgctgtccagcgtggacg
ggtgacagcagtccctgcggccagctctcaggcaggggtgcctgtcaggacatcacgctg
tccaaagctccactcgggcctcaataccccttcacggggatggatgaccgggaggcctgg
ccctccgtcttttataatcggacctgccagtgctttggcaacttcatgggattcaactgt
ggaaattgcaagtttggcttttggggaccaaactgcacagagaagcgacttttggtgaga
agaaacatctttgatttgagcgtcccagagaagaacaaatttcttgcctacctcacttta
gcgaagcatactatcagcccagactatgtcatccccataggcacctatggccaaatgaat
aatggatctacacccatgtttaatgacatcaatgtttatgacctcttcgtctggatgcat
tactatgtgtcaagggacacactgcttggagggtctgaaatctggaaagacattgatttt
gctcatgaagcccctggtttcctgccttggcacagactcttcttgttgctgtgggaacaa
gaaatccagaagctgaccggggatgagaacttcactattccatattgggattggcgagat
gctaaaagctgtgacatttgcacagatgagtacatgggagggcacaacccagcaaacccg
aacttactcagcccagcatccttcttctcctcttggcagatcatctgtacccgattggag
gagtacaatagccgtcaggctttatgtgatggaactccagagggaccattactgcgcaat
cccggaaaccatgacaaagccaggaccccaaggctcccctcctctgctgatgtggaattt
tgcctaagtctgacacaatatgaatcggattccatggataaagctgccaatttcagcttt
aggaatacactggaaggatttgctagtccacttactgggatagcagatgcctctcaaagc
agcatgcacaatgccttgcacatctatatgaatggaacgatgtctcaggtacagggatct
gccaatgatcccatttttcttcttcaccatgcatttgttgacagtatttttgaacaatgg
ctccgaaggcaccatcctcttcaagaagtgtatccagaagccaatgcacccattggacac
aaccgggagtcctacatggttccttttatacctctatacagaaatggtgatttctttatt
tcatccagagatctgggctatgactatagcaacctacaagattcagaacgggacattttt
caagattacattaagcccttcttggaacaagcaagtcggatctggccatggctcattggg
gctgctgtggtaggctctgtcctcacggctgtgctgggaaggctcactagcctattgtgt
cgtcgcaaaagaaagcagctccgtgaagaaagacagcccctcctcatggaaaaggaggat
taccacagtttgttgtatcagactcatgtataa

DBGET integrated database retrieval system