KEGG   Francisella cf. novicida Fx1: FNFX1_0440Help
Entry
FNFX1_0440        CDS       T01937                                 

Definition
hypothetical protein (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
fcf  Francisella cf. novicida Fx1
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:fcf00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:fcf00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
418416..419720
Genome map
AA seq 434 aa AA seqDB search
MKAVRVKKLSKLADEITINISGAKNALLHLIFASLIPDTKTKFTNVPTTLLDYKGAKEIL
ENVGAKVIEKGEEVTIDTAAISNETLELCGEMTSKTRCSLMLLGSLLKKKGRVKIGFPGG
CSFSEKRPFDIHLNGLEALGAEVKLADDHIEVIYKEEKNAEFKMPFPSVGATMNLLMYAV
TGNSEVVLENVALEPEVVTLIDYLNQCGANIDFDADSRKIKILGVMRLNGCEFEIIFDRI
QAMTYAAMAYLYKTNVTITNINTQDTYSIKKPLEKLTNAGAKWEYNQANRSIKFFGKDSC
IKGVDIIAAPFPHFPTDLQPIYAVMLFMANSSSTIQDTVYPERINYVYQIRKMGFNISID
NTLIKINPLKNLNDIRPAVMSVKDLRAGMACLMAGSLLDEFSTINNAHQIFRGYNNLIEN
MSHFMRIEILNDNV
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcagtaagagtaaaaaagttaagtaagcttgctgatgagataactattaacatt
agtggtgcaaaaaatgctttgttacatctaatttttgcaagcttaattccggatactaaa
acaaaatttactaatgttccaacaactcttttagattataaaggggctaaggagatctta
gaaaatgttggtgctaaagtcattgaaaagggtgaagaagtaactattgatactgcagct
atttcaaatgaaactttagaactatgtggggaaatgacatctaagacacgctgttcctta
atgcttttaggttcattacttaagaaaaaaggtcgtgttaagattggttttcctggtggt
tgtagttttagtgaaaaaagaccttttgacatacacttaaatggattagaagcattaggt
gctgaggttaagttggctgatgatcatatagaggtaatttataaagaagaaaaaaacgca
gagtttaaaatgccttttccatcggttggcgcaactatgaatttactaatgtacgccgtg
acaggtaattctgaggttgtacttgaaaatgttgctttagagcctgaggttgtcacatta
atagactatcttaatcaatgtggtgcaaatattgattttgatgctgatagcagaaaaata
aaaatcttaggtgttatgagattaaatggctgtgagtttgaaattatttttgaccgtatt
caagctatgacctatgccgctatggcgtatctgtacaaaacaaatgttacaattacaaat
attaatactcaagatacatacagtatcaaaaagcctttggaaaaattgactaatgcagga
gctaaatgggagtataaccaagctaatcgtagtattaagttttttggtaaggatagttgt
attaaaggagtcgatataattgctgcaccttttccacattttcctaccgatttacagcca
atatatgcagtaatgttatttatggcaaatagctctagtactattcaagatacggtttac
cctgagcgcataaattatgtgtatcaaattcgtaaaatgggctttaatatatctatagat
aatactcttataaaaataaatccacttaaaaacctaaatgatatacgtccagcagtgatg
agtgtcaaagatttacgcgctggtatggcatgcttaatggccggatcattattagatgaa
ttttcgactattaataatgctcatcagatatttagaggttataataaccttatagaaaat
atgtctcattttatgcgaatagagattctaaatgataatgtttag

DBGET integrated database retrieval system