KEGG   Fervidicoccus fontis: FFONT_0329Help
Entry
FFONT_0329        CDS       T01936                                 

Definition
2-oxoacid:ferredoxin oxidoreductase subunit gamma
Orthology
K00172  
pyruvate ferredoxin oxidoreductase, gamma subunit [EC:1.2.7.1]
Organism
ffo  Fervidicoccus fontis
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ffo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    FFONT_0329
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FFONT_0329
   00020 Citrate cycle (TCA cycle)
    FFONT_0329
   00620 Pyruvate metabolism
    FFONT_0329
   00640 Propanoate metabolism
    FFONT_0329
   00650 Butanoate metabolism
    FFONT_0329
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    FFONT_0329
   00680 Methane metabolism
    FFONT_0329
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    FFONT_0329
Enzymes [BR:ffo01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     FFONT_0329
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(313831..314418)
Genome map
AA seq 195 aa AA seqDB search
MLQEIIFYGRGGQGAVTSSELLAAAASYENFYSQAFAFYGAERRGAPVMAFSRISDSVIY
KHGMFFEVDSLVVLDRAVLPKLKDIKIRKNGNLLINASLINLNDLKKYLNFIENVKVYTV
DANAIAKNEGLVMAGWPLVNTSILGAFIKILGIIKLDSLLNAIDENFEGQIAEKNKKAVK
VAYESLKEMGEIKNE
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
ttgttgcaagaaattatattttatggaagaggagggcaaggagcagttacatcttctgaa
cttttagcggctgcagcatcatatgaaaacttctattctcaagcctttgcattttacgga
gcggaaagaagaggagctccagtaatggctttcagcaggataagcgatagtgtaatatac
aaacatggaatgttttttgaagtggatagtctagtagttttagatagagctgttttgcca
aagctaaaagatattaaaattaggaaaaatggaaatctgttaattaatgcttcattaatc
aatctaaatgacctaaaaaaatacttgaactttatagaaaatgttaaagtttatactgtt
gatgccaatgctatagcaaaaaatgagggcttagtaatggcagggtggcctctagtaaat
acaagcatattgggagctttcataaaaatcctcggaataataaaactagattctctatta
aatgcaatagatgaaaacttcgaaggtcagattgcggaaaagaataaaaaagcggtaaaa
gttgcttatgaaagcttaaaggaaatgggtgaaataaaaaatgagtaa

DBGET integrated database retrieval system