KEGG   Flavobacterium indicum: KQS_02305Help
Entry
KQS_02305         CDS       T01781                                 

Definition
(GenBank) Glycoside hydrolase family 20
  KO
K12373  hexosaminidase [EC:3.2.1.52]
Organism
fin  Flavobacterium indicum
Pathway
fin00511  Other glycan degradation
fin00520  Amino sugar and nucleotide sugar metabolism
fin01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fin00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    KQS_02305
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    KQS_02305
Enzymes [BR:fin01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     KQS_02305
Chaperones and folding catalysts [BR:fin03110]
 Intramolecular chaperones
  Others
   KQS_02305
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_20 Glyco_hydro_20b Fn3_assoc CHB_HEX_C_1 F5_F8_type_C Glycohydro_20b2 zf-C2H2_jaz CHB_HEX_C ANAPC10
Motif
Other DBs
NCBI-ProteinID: CCG52453
UniProt: H8XQF9
Position
complement(547301..549574)
Genome map
AA seq 757 aa AA seqDB search
MKNIYFLLLLSFSWAIGQNHPIIIPQPQHLKVGNSFFTLSKNTEIETNQKDSFEVTYLQN
AIFNQTGLSLQSQKKSKVSSKIILNLRLIDTISTKIKSRYEIIIKHNQIEINANSSEGIF
YAIQSLLQIIPSEKKQTISIPCLELQDEPKYKWRGMHLDCARHFFPKEFIKKYIDYLATY
KFNVFHWHLTDDQGWRIEIKKYPKLTSIGAWRNGSMIGHYSEQKFDNIRYGGYYTQEEIK
EIVAYASARHITIVPEIEMPGHAVAALAAYPEYSCTGGPFEVGKTWGVLDDVFCPKDETF
TFLENILTEVIALFPSEYIHIGGDECPKTRWKACPHCQKRMKTENLKDEHELQSYFIQRI
ERFVNSKGRKIIGWDEILEGGLAPNAAVMSWRGTEGGIAAAKQKHYVVMSPGSHCYFDHY
QGNPKNEPIAFGGYTPVEKVYSFNPTPKELSPEEAKYIMGAQANVWTEYIETPTHVEYMI
FPRMLALSEVLWGTSNPEKYTEFQNRMFQHFDILEKKGINFSKAVFEITSKVKSAENGNG
VLFELHSAKNTNLIRYTTDGTNPNTNSFQYLHPIEIKNSQTIKAASFENEKQKSAVVEQV
FTLNKATGKKINLVDAPHENYNVGGTFTLIDGISANRGKLGKDWLGFSGKDLNATIDLGK
SEVINKVTISVLESQGSWIYYPKKIGILLSEDGINYRGINIISAEEIKKSGGKVNITLNA
EKAQFVKVIAYNAGIITERLPGAGSNAWLFVDEIGVE
NT seq 2274 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacatttactttttattgttacttagttttagttgggcaattggtcaaaatcat
ccaatcattattccacaacctcagcatttaaaagtcggaaactcgttttttacactttca
aaaaataccgaaattgaaaccaatcaaaaggacagttttgaagtgacatatttacaaaac
gctatttttaatcaaaccggactatcacttcagtctcaaaaaaaatcaaaagtatcttct
aaaataattttaaacctacgtttaattgatactatttctacaaagataaaaagtcgatat
gaaattattattaaacacaatcaaatagaaataaacgcaaatagttccgaaggaattttt
tatgcaattcaaagtttattacaaattattccaagcgaaaaaaaacaaaccatttctata
ccttgtcttgaacttcaagacgaaccaaaatataaatggcgtggcatgcatttggattgt
gctcgtcatttcttccccaaagaatttataaaaaaatatattgattacttagctacctat
aaattcaatgtctttcattggcatttaaccgacgatcaaggctggcgaattgaaataaaa
aaatacccaaaattaacgagcattggcgcttggcgaaatggctccatgataggtcattat
agtgaacaaaaattcgacaacattcgctatggtggctattacacccaagaagaaattaaa
gaaatagttgcatatgcttcggcacgacacattactattgttccggaaattgaaatgccc
ggacatgccgttgccgctttagcagcttacccagaatattcatgtacaggtggcccattt
gaagttggaaagacatggggtgttttagacgatgtgttttgtccgaaagacgaaaccttt
acatttttagaaaacattttaacggaagtaatagcacttttcccttctgaatacattcat
attggtggtgatgaatgtccaaaaacacgttggaaagcctgtccacattgccaaaaaaga
atgaaaaccgaaaatttaaaagacgaacatgaattacaaagttatttcattcaacgtatt
gaaagatttgttaatagtaaaggaagaaaaattattggttgggatgaaattttggaagga
ggtttagctccaaatgctgccgtaatgagttggcgtggaacggaaggcggaattgctgct
gccaaacaaaagcattatgtagtcatgtctccaggatctcattgttattttgatcattat
caaggcaatcctaaaaacgaacctattgcgtttggcggctatactcctgttgaaaaagta
tattcattcaatccaacaccaaaagaattgtcaccagaagaagccaagtacatcatggga
gcccaagcgaatgtttggaccgaatatattgaaacaccaacccatgtagaatacatgatt
ttcccaagaatgcttgcgttatctgaagtactctggggtacatctaaccccgaaaaatac
accgaatttcaaaacagaatgttccaacattttgatattttggaaaagaaaggaatcaat
ttcagtaaagctgtttttgaaattacttccaaagttaaatccgctgaaaatggaaatgga
gtactgttcgaattacattccgcaaaaaacacaaacctcattagatatacaacagacggt
accaatccaaataccaattctttccaatatttacatccaattgaaattaaaaatagtcaa
actataaaagccgcttcttttgaaaatgaaaaacaaaaaagtgctgttgtggaacaggta
tttactttaaataaagctacaggaaaaaaaataaatttagttgatgcgccacatgaaaat
tacaatgttggtggaacattcactttaattgatggaatttctgctaatcgaggcaaatta
ggaaaagattggctcggattttctggaaaagacttaaatgcaacaatcgatttagggaaa
tcagaggttatcaataaagtgacaattagtgttttagaaagccaaggcagttggatttat
tatccaaaaaaaattggtattttactatccgaagatgggataaactacagaggtattaat
attatttctgcggaagaaattaaaaaatcaggcggtaaagtcaacataacattgaatgca
gaaaaggctcaatttgtaaaagtcattgcttataatgccggaataattacagagagatta
cctggagcaggttctaatgcttggctatttgtggatgaaattggtgtggaataa

DBGET integrated database retrieval system