KEGG   Finegoldia magna: FMG_1499Help
Entry
FMG_1499          CDS       T00661                                 

Definition
ATP-dependent exodeoxyribonuclease subunit alpha
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
fma  Finegoldia magna
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:fma00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    FMG_1499
Enzymes [BR:fma01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     FMG_1499
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1647585..1649816)
Genome map
AA seq 743 aa AA seqDB search
MKFTATVKNIIFENESNGFRIFSVDKDGEERIIKGNSFKIMPGDFLDIEANKVQDPKYGE
QYNIISVERSNKPSMYNIINYLQSGLIKGIGETTARRIVEEFGEDTMEILKNSPSKLLQV
KGIGKKNYKKIKESLDEKKEYAEIFLYLQSLGLSLHQANIISDFYKEDTKKIIMQNPYTL
IDDIRGIGFRTADIIAQRIDIEPDSPFRIKAAFKYFMEKEANSNGNCYVLEDDLIEGVEK
LLDIEIKNRQETLESLIVSGIIAIDDTDDENRVYLPQIEKSEMRCAMNIANILKTEIEDE
FDVEYELSKLESEHLDDLQIEAIKKSMTEKMLIITGGPGTGKTTIINNITKIFKNNDKEI
ILAAPTGRAAKRLSESCNEEAKTIHRILGYIPVEDGTIFDHDEDNPIDCDLIIIDEASMM
DIFIADSLLRALDSNTRVVFVGDCDQLPSVQAGNVLNDLIECGEITTIKLTKIFRQAQNS
NIIVNAHRINNGEFPILNEKGKDFFFIEENDPERAKQTILDLCAQRLPNFYKKDEFDDII
VLTPMKKSSCGTKELNTALQEVLNPKTPMTEEIEQRDRIFRLNDKVMQIKNDYTKEFIDD
DAMGVFNGDIGRVTYVDPIDETVDVLFDDKTASFTKKECDGLTLSYAITIHKSQGSEFPI
VVIPVTQAPFMLLTRNLLYTAITRAREIVVLVGSLKILRQMISNNKIMKRNSGLDRRIKQ
YMDFDIDDDEQEMMKEMFEDEGF
NT seq 2232 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttacagcgactgtcaaaaatataatattcgaaaatgagtccaatggttttagg
attttttccgtagataaggacggggaagagagaatcatcaagggaaatagtttcaaaatt
atgcctggagatttcttggatattgaggcaaacaaagttcaagatccaaaatacggcgag
caatacaacataatttccgttgaaagatccaataagccaagcatgtacaatatcatcaat
tatcttcaaagcggtttgattaaaggaatcggagaaactactgcgagaagaatcgtcgaa
gaatttggcgaagatacgatggagattttaaaaaattctccatccaaattattgcaagta
aaaggaattggcaagaaaaattacaagaaaatcaaagaatctctcgatgagaaaaaagaa
tacgcagagattttcttgtatttgcaatcgttggggctaagtcttcatcaagcgaatatt
atttctgatttttacaaggaagacaccaagaaaattatcatgcaaaatccatacactttg
attgacgacattaggggaattggattcaggacggcggacatcattgcgcagagaatcgac
atcgagccggattctccatttagaatcaaagctgcgttcaaatattttatggagaaggaa
gcaaattccaacggaaattgctacgtattggaagatgatttgatagaaggtgtcgaaaaa
cttctcgacattgaaatcaaaaacagacaagaaacgttggagtctttgattgtcagtgga
attatcgccattgatgatacagatgatgaaaacagagtctaccttccacaaatagaaaaa
tccgagatgagatgtgcgatgaatattgcaaatattttgaaaacagaaatcgaagatgag
tttgatgtggagtacgagctttccaagcttgaatcagaacacttggatgatttgcaaatc
gaagctatcaagaaatctatgaccgaaaaaatgttgataattacaggtggacctggtacg
ggaaagactacgattatcaacaatattacgaaaattttcaaaaataatgacaaggaaata
attctcgcggcgcctactggacgtgcggcgaaaagattgtcggaaagttgcaacgaagaa
gcgaagactattcacagaattctgggatatattccagttgaggatggaacgattttcgat
cacgacgaggacaatccaattgattgcgatttgataattatagatgaagcgagtatgatg
gatattttcatcgcggacagtttgctgagagcattggattctaatactagggttgttttt
gttggagactgcgaccagcttccgagtgtgcaagcgggaaatgtgctaaatgatttgata
gaatgtggagaaatcactacaataaaattgacgaaaattttccgtcaagcgcaaaactcc
aacataattgtgaatgcgcacaggattaacaacggagagtttcctattttgaatgaaaaa
ggcaaggattttttctttattgaagaaaatgatccagaacgcgccaagcagacgattctc
gatttgtgcgcacaacgacttcccaatttctacaaaaaagatgagtttgacgatataatt
gtgctaactccaatgaaaaaatctagttgcggaactaaagaattgaacacagctttgcaa
gaagttttgaatccaaaaactccaatgactgaagaaattgagcaacgagacaggattttc
aggctcaacgataaagttatgcaaatcaaaaatgattatacgaaagaattcatcgacgat
gatgcgatgggcgttttcaacggagatatcggaagagttacatacgtcgatccgattgat
gagacggttgatgtgttgtttgacgataaaactgcgagtttcacgaaaaaagaatgcgat
ggtttgacgctatcatatgcgattacgattcacaaatcacaaggcagtgagtttccgatt
gtagtaattcccgttacgcaggcaccatttatgttgttgacgagaaatttgctctatact
gcaatcacaagagcgagagaaatcgtcgttttggttggaagcttgaagattttacgacaa
atgatatccaacaataaaataatgaagagaaattcaggattggatagaagaatcaaacaa
tacatggattttgatatcgacgatgacgaacaggaaatgatgaaagagatgttcgaagat
gagggattttag

DBGET integrated database retrieval system