KEGG   Fervidobacterium nodosum: Fnod_0950Help
Entry
Fnod_0950         CDS       T00579                                 

Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase (EC:1.1.1.267)
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
fno  Fervidobacterium nodosum
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:fno00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Fnod_0950
Enzymes [BR:fno01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     Fnod_0950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1038417..1039529
Genome map
AA seq 370 aa AA seqDB search
MEEKTVVILGATGSIGTQSVDVISKLKNYKLVGISFGKNRNLAEEIVQRFDVKVYHGGVE
LSVGRRVDSIGALLELTKPDITICAIPGFEGVKATIEALKYTRRIALATKESMVCAGKFV
KELAKKNNVEIVPVDSEHSAIFQIYEPHIDHIVITASGGAVRDLPLDKIAGLTPEEVLKH
PTWNMGGRITVDSATMVNKFFEVVEAHELFDLPYEKIEVYINPSSFIHGMVFLKDGTIKI
HAGKPDMRVPIAYSLTYPSREYTSYVAQVDEFDMRLLPVEKARYPLFFFGLEIAKSGGLA
ERIAFNSADEIAVQYFLEKKILFGKIEKIVTKTVEEVQKRAITVNSLEDVYKVDELSRKI
TEEVLYDCIN
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
ttggaagaaaaaaccgttgtaatattgggtgcaacaggttcaattggaactcaaagtgtt
gatgtcatatcaaaattgaaaaattacaaattggttgggatatcttttggaaagaataga
aatttagctgaagagattgttcaaaggtttgatgtcaaggtttatcatggcggcgttgag
ttatcggttggaagaagggttgatagtataggtgcgttattggaattgactaaacctgat
ataactatttgtgcgattccgggctttgaaggagttaaagccacaatagaagctttaaaa
tacacaagaagaatagctcttgccacgaaagagtcgatggtgtgcgctggaaagtttgta
aaagaattagctaaaaagaataacgttgagattgttccagtagatagtgaacattcggct
atatttcaaatatacgaaccgcatatagaccatatagttataaccgcatcgggtggtgct
gtaagagatttaccactagataaaatagcgggcctcacacctgaagaagtcttaaaacat
ccaacgtggaatatgggtggaagaataaccgttgattccgcaacgatggtgaataaattt
tttgaagtggttgaagcgcatgagttattcgatttaccatacgaaaagatagaagtttac
attaatccatcaagctttatccacggaatggtatttttgaaggatggaacgataaaaatt
cacgcgggtaaaccagatatgcgtgttcctatcgcttattctttgacttacccttcaaga
gaatatacttcatatgtagctcaagttgatgaatttgatatgaggttattacctgtcgag
aaggcgcgttatcctctcttcttcttcggacttgaaattgcaaaatcagggggactcgcg
gaacgtatagctttcaacagcgcagatgagatagctgtgcaatatttccttgaaaaaaag
attttatttggtaaaattgaaaaaatagtaactaaaaccgtagaagaggtgcaaaaaagg
gccataacagttaattcactcgaagatgtttacaaagttgacgaactatcaagaaaaata
acagaggaggttttatatgactgtattaattaa

DBGET integrated database retrieval system