KEGG   Faecalibacterium prausnitzii SL3/3: FPR_13510Help
Entry
FPR_13510         CDS       T02592                                 

Definition
alpha-1,4-glucan:alpha-1,4-glucan 6-glycosyltransferase (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
fpa  Faecalibacterium prausnitzii SL3/3
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:fpa00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    FPR_13510
Enzymes [BR:fpa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     FPR_13510
Exosome [BR:fpa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   FPR_13510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(<1368321..1370282)
Genome map
AA seq 654 aa AA seqDB search
MKPTEEKIQSNTSDLPVYLFKQGNNCEAYRYFGAHLETRVGESGVVFRVWAPHAVAISVV
GDFNSWKPGSHPMHKVDGDSVWELFIPGMKEYDVYKYCVTTRAGDLVYKADPYAFHAETR
PSNGSKVYDLSGFAWHDAAWQTAQKKADVINGPMNIYEMHAGSWKMKEGGKPYNYSELAD
ELIPYIKDMGYTHVELLPVMEYPFDGSWGYQVTGYFAPTSRYGTPKDFMAFVDKMHAAGI
GVIMDWVPAHFPKDQFGLYNFDGEACYEDPNPKRGEHKEWGTMVFDFGRNEVQSFLISSA
LYWLEQYHIDGLRVDAVASMLYLDYNRKQGEWEPNKDGGKENLEAIAFLRKLNNTVLGRH
PHKYMIAEESTAWPMVTKPASDGGLGFNFKWNMGWMNDMLSYMKTDPLFRSGNHNKVTFS
FFYAFSENFVLPISHDEVVHGKGSLLNKMPGEYDDKFANLRTFFGYMMAHPGKKLLFMGQ
EFGQFAEWNEAKQLDWMLLDYDKHAELQNYVRTLNAFYKEHPALWQIDYSWEGFQWIVPD
DSQQSVIAFLRKDAAGKQILVICNFNPVLREGYTLGAPVSGTYKEILNSDDAAFGGSGTV
HNKPVRTHKKPQHGFEQSITVTLPPMSTLYFEVPTKRTRKAAEDSADKPAKKTA
NT seq 1962 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccgaccgaagaaaagattcagagcaacacatcggacctgccggtgtacctgttc
aagcagggcaacaactgcgaggcttaccgctacttcggcgcacatctggaaacacgggtc
ggggagtccggcgtcgtgttccgcgtgtgggcaccgcacgccgtagccatcagtgttgtg
ggcgacttcaacagctggaagcccggcagccatcccatgcacaaggtggatggcgattcc
gtgtgggaattgttcattcccggcatgaaggaatacgatgtttataaatattgcgtgacc
acccgtgcaggcgaccttgtttacaaggccgatccctacgccttccacgccgagacccgg
ccgtccaacggcagcaaggtctacgatctgtccggctttgcatggcacgatgccgcatgg
cagaccgcgcagaaaaaggcggacgtgatcaacggcccgatgaatatctacgagatgcac
gccggcagctggaagatgaaggagggcggcaagccctacaactactccgagctggcggac
gagctgatcccgtacatcaaggatatgggctacacccatgtagagctgctgccggtgatg
gaatatccgtttgacggcagctggggctatcaggtcaccggctattttgcacccaccagc
cgctacggcacccccaaggactttatggccttcgtggataagatgcacgccgccggcatt
ggcgtcatcatggactgggtgcccgcccacttccccaaagaccagttcggcctgtacaat
tttgacggcgaggcctgctacgaggaccccaaccccaagcgcggcgagcacaaggagtgg
ggcaccatggtgttcgactttggccgcaacgaggtgcagagcttcctcatttccagcgca
ctgtactggctggagcagtaccacatcgacggtctgcgcgtggatgccgtggcctccatg
ctgtatctggactacaaccgcaagcagggcgaatgggagcccaataaggacggcggcaag
gagaaccttgaagccatcgctttcctgcgcaagctgaacaacaccgtgctgggtcgtcac
ccccacaagtacatgatcgccgaagagtccaccgcgtggcccatggtcacaaagcccgct
tcggacggcggtctgggcttcaacttcaagtggaacatgggctggatgaacgatatgctc
agctacatgaagaccgacccgctgttccgctccggcaaccacaacaaggtgactttcagc
ttcttctacgctttcagtgagaactttgtcctgcccatcagccacgatgaggtggtgcac
ggcaagggcagcctgctgaacaagatgcccggcgagtatgacgacaagtttgccaatctg
cgcaccttcttcggctacatgatggcacacccgggcaagaagctgctgttcatgggacag
gagttcggtcagtttgcagagtggaacgaggcaaagcagctggactggatgctgctggac
tacgacaagcacgccgagctgcagaactacgtccgcaccctgaacgccttctataaagag
caccccgccctctggcagatcgattacagctgggaaggcttccagtggatcgtgccggac
gactcgcagcagagcgtcatcgctttcctgcgcaaggatgccgccggtaagcagatcctt
gtcatctgcaacttcaaccccgtcctgcgcgagggctacaccctcggcgcaccggtgtcc
ggcacctataaagagattctgaacagcgacgatgccgctttcggcggctccggtaccgtg
cacaacaagccggtgcgtacccacaaaaagccgcagcacggctttgagcagagcatcacc
gttaccctgccgcccatgagcactttgtactttgaggtgcccacaaagcgcacccgcaag
gcagcagaggacagcgcggacaagccggcaaaaaagaccgcc

DBGET integrated database retrieval system