KEGG   Francisella philomiragia subsp. philomiragia ATCC 25017: Fphi_1546Help
Entry
Fphi_1546         CDS       T00652                                 

Definition
(RefSeq) hypothetical protein
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
fph  Francisella philomiragia subsp. philomiragia ATCC 25017
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:fph00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Fphi_1546
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Fphi_1546
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Fphi_1546
Enzymes [BR:fph01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Fphi_1546
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1675929..1677725
Genome map
AA seq 598 aa AA seqDB search
MYKILNFYTKEEVSTDSFVFAGENEPWEIQMDIDEISKKINKDYFTQASPCLSKYIPFMP
IKDPSSFVSLREAATPLLKSKIIGKELGINLYFKVEGKNPTGSFKDRGSAVDITVAKELG
AKGIVLASTGNMAASCACYAAAAKMPCFIIVPEGVAASKLAQVMSYGGKIVQVKGSYNEA
AKLAYDIAKSKDFFLAGDYAFRVEGQKTAAFELIDQLLFQVPDEVIIPIGCGTNMTAYYK
GFCEYKELGFINSLPKLTGVQSTEADTLARAYQKNQNRIEPLKTANTIATAIAVPYPIDG
DKAIDAIYSTGGESTAVTDMKMLEAQYLLSTKEGLFVELASASTIAHLLKKYEEGKLQKG
STVVCVLSGEGLKDPAVVLKSAIQPPIIYPAEADFDRLYNSHFFDNKTMLFIEQNEVIFD
QVPTLEEVKKTLGKLFGANYDQNFLAKVRELIERFLVKGKSINVSDIQDIIQDATEMADA
ISKDILDVQSFKVNVELDQKSVAEVTVKVADQLYFASSSGVGPVDAVLNALCKACPSDIS
YKLTDYKVKIRGQGADAVVYVEMSLEKEGIKSIGKAVSPDIIQASVEAFIDAYNIAYA
NT seq 1797 nt NT seq  +upstreamnt  +downstreamnt
atgtataaaatattaaacttttacaccaaagaagaagtttctacagatagttttgtgttt
gctggggagaatgagccttgggaaattcagatggatattgatgagattagtaaaaaaatt
aacaaagactattttactcaagcatcaccatgtttatctaaatatataccatttatgccg
ataaaagatccatctagttttgtatctttaagagaagcagctacaccattgcttaagagt
aaaataataggtaaagagttaggaattaatctatattttaaggttgagggtaaaaatcct
acaggttcatttaaagatagaggatctgcagttgatataacagttgcaaaagagcttgga
gctaagggtattgtgctagcatctactggtaacatggcggcttcatgtgcttgttatgca
gcagcagctaaaatgccttgttttattattgttccagaaggtgttgcagcttctaaatta
gctcaagttatgtcttatggtggtaaaatagttcaagttaaaggtagttataatgaagct
gcaaaattagcttatgatattgcaaaatcaaaagatttctttttggctggagattatgca
tttagagtcgagggtcaaaagacagcagcatttgaacttatagatcagttattattccaa
gtgccagatgaggttataatacctataggctgtggtacaaatatgactgcttattataaa
ggtttttgtgagtataaagagttaggttttattaattctttgcctaaacttactggtgtt
cagtctactgaagcagatacattagctagagcatatcaaaagaatcaaaatagaattgag
cctctaaaaacagctaatacaattgcaacggcaatagctgtaccatatcctattgatggt
gataaggctatagatgctatatatagtactggtggagagtctactgcagttacagatatg
aaaatgttagaggctcaatatttgctatctactaaagaagggttgtttgtggaactggca
tcagcgtcaactattgcacatttgctcaaaaaatatgaagaaggtaaacttcaaaaagga
agtacagtagtgtgtgtactatctggagaaggtctaaaagatcctgcggtagttctgaaa
tctgctattcagccaccaattatatatcctgcagaggctgattttgacagactttataat
agccatttctttgataataagacaatgttattcatagagcaaaatgaagtaatatttgat
caagttccaactcttgaggaagttaaaaaaactcttggcaaattgttcggagcaaattat
gatcagaatttcttagctaaggttagagagctgattgagagattcttagtcaagggtaaa
tcaattaatgtctctgatatacaagatattatccaagatgctactgagatggcagatgcc
attagtaaagatatcttagatgtacagtcatttaaggtaaatgtagagctagatcaaaaa
tctgtagccgaagttactgttaaggttgcagaccagttatactttgcatcaagttctggt
gttgggcctgtagatgctgttttaaatgctttatgtaaagcttgcccgagtgatattagc
tataagctaactgactataaagtgaaaatacgtgggcaaggtgctgatgctgttgtttat
gtagagatgagcttagaaaaagaaggtattaaaagtattggtaaagcagtttctccagat
ataatccaagcatctgtagaagcatttatagatgcatacaatattgcgtatgcataa

DBGET integrated database retrieval system