KEGG   Frankia sp. EuI1c: FraEuI1c_6376Help
Entry
FraEuI1c_6376     CDS       T01354                                 

Definition
UTP-GlnB uridylyltransferase, GlnD (EC:2.7.7.59)
Orthology
K00990  
[protein-PII] uridylyltransferase [EC:2.7.7.59]
Organism
fri  Frankia sp. EuI1c
Pathway
Two-component system
Brite
KEGG Orthology (KO) [BR:fri00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    FraEuI1c_6376
Enzymes [BR:fri01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.59  [protein-PII] uridylyltransferase
     FraEuI1c_6376
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(7836030..7838459)
Genome map
AA seq 809 aa AA seqDB search
MDRPTGEPGPGATPAPDAGGPDAVAGLVALRGRDDAFPDLVGAPLRAALTDRADAALRAL
FGNPGPGLALIAVGGYGRREPAFGTDLDLVLVHDGKRGSDALATIADGIWYPVWDAGVGL
DHSVRTVEQAVSVADGDLKAALGLLEARLVVGDEALAARLVEALRTRWRARAHRRLPELA
EFQAERARRVGEVAFLLEPDLKEGRGGLRDVQALHALAAAWVAEPPGERVRAAQQLLLDV
RGEIRRVAAGRDQDRLLLQDGDAVAAALGYVAAGAAPGAEQPDSFALAHAVADAGRAISW
TWDTTWNQVSGALKARSRWRSARPIRRPLDAGVVEQDGEVQLARDADPAGDPALVLRAAA
AAARAGIPLGRYAIDRLARDAHPLPDPWPPAALDALVALLAAGDNAVPVLESLDQVGLLV
RVLPEWAAVRSRPQRNPYHRYTVDRHLIEAAAKAAQHTREVDRPDLLLLGALLHDIGKGY
PGDHTDAGILIVEKLGPRLGLPPDDVDVLVAMVRHHLLLPDSATHRDIDDPATIEAVAQA
AGSIRVLGLLHRLTEADSKATGPTAWSAWKARLIGDLVARATAVLGGGPVPYAGELSERQ
LALLALPDEHLVQVNKLPDEGMYEVVVLAPDHVGLLAVTAGVLALNRLDIRRASARGADG
RALLQAAVAATHGQEPDPRRLLADVRRGLEGRLDVAGQLAAREEAYATRRPWRTPGPPRA
TFDDSGSRTVLEVRAPDRAGVLFRIVRALAGVGIDVHTAIVATIGLDVVDAFYIQEADGA
EVVGEARRREVSEAVAAALMTSDTPAPEA
NT seq 2430 nt NT seq  +upstreamnt  +downstreamnt
gtggatcggccgactggtgagcccggccccggtgccacccccgcaccggacgcgggcggc
cccgacgcggtcgccggactcgtggcactgcgcggtcgcgacgacgcctttccggacctg
gtcggcgccccgctgcgggccgcgctgaccgatcgggccgacgcggcgctgcgcgcgttg
ttcgggaacccggggcccggcctcgcgctcatcgccgtcggtggctatggccgccgcgag
ccggccttcggcacggatctcgacctggtgctggtgcacgacggcaaacgcggctccgac
gcgctcgccaccatcgccgacgggatctggtacccggtctgggacgcgggggtcggcctg
gaccacagcgtccgcaccgtcgagcaggccgtgtccgtggccgacggcgacctgaaggcg
gcgctggggctgctcgaggcccgcctggtcgtcggcgacgaggcactcgcggcccggctc
gtcgaggccctgcgcacgcgctggcgggccagggcccaccggcggctgcccgagctcgcc
gagttccaggccgaacgggcccgccgggtcggcgaggtcgcgttcctgctggagccggac
ctcaaggagggccgcggcggcctgcgcgacgtgcaggcactgcacgccctggcggccgcc
tgggtcgcggagcctccgggtgagcgggtgcgcgcggcccagcagctgctgctcgacgtc
cggggcgagatccgccgcgtcgccgcgggccgggaccaggaccggctgctgctccaggac
ggcgacgcggtcgccgccgccctcggctacgtcgccgcgggtgcggcccctggtgccgag
cagcccgactcgttcgcgctcgcgcacgccgtggccgacgccggccgggccatctcgtgg
acctgggacaccacctggaaccaggtcagcggcgcgctgaaggcccgctcgcgctggcgc
tcggcccgcccgatccgccgcccgctggacgccggcgtcgtcgaacaggacggcgaggtc
cagctcgcccgcgacgccgacccggccggcgacccggcactcgtgctgcgcgcagccgcc
gccgcggcccgcgccggtatcccgctgggccggtacgcgatcgaccggctcgcccgggac
gcgcacccgctacccgacccgtggccgccggccgcgctcgacgcgctggtcgccctgctc
gccgccggcgacaacgccgtcccggtgctggagtcgctcgaccaggtcggcctgctcgtc
cgcgtcctgccggaatgggccgccgtccgcagccgtccgcagcgcaacccgtaccaccgc
tacaccgtcgaccggcacctgatcgaggcggcggcgaaggcggcccagcacacccgcgag
gtcgaccggcccgacctgctgctgctcggcgcgctgctgcacgacatcggcaagggctac
cccggcgaccacaccgacgccggcatcctgatcgtggagaagctcgggccccggctcggc
ctgccgccggacgatgtcgacgtgctggtcgcgatggtccgccaccacctgctgctgccc
gactcggcgacccaccgcgacatcgacgacccggccacgatcgaggccgtcgcgcaggcg
gccggcagcatccgcgtgctcggcctgctgcaccggctcaccgaggcggactcgaaggcg
accggcccgaccgcctggagcgcctggaaggcgcgtctcatcggcgacctggtcgcgcgg
gcgacggccgtcctcggcggcggcccggtgccctatgccggtgagctcagcgagcggcag
ctcgccctgctcgcgctgcccgacgagcacctggtgcaggtcaacaagctgccggacgag
ggcatgtacgaggtcgtggtgctcgcccccgaccacgtcggcctgctcgcggtcacggcc
ggcgtgctcgcgctcaaccggctcgacatccggcgggcctcggcccgcggcgcggacggc
cgggcgctgctgcaggcggccgtcgcggcgacccacgggcaggagcccgacccgcgccgg
ctgctcgccgacgtccgccgcgggctggagggccggctcgacgtcgccggccagctcgcg
gcccgcgaggaggcctacgcgacccgccggccctggcgcacccccggtccgccgcgggcg
acgttcgacgactccggctcgcggaccgtgctggaggtgcgcgcgcccgaccgggccggg
gtgctgttccggatcgtgcgggcgctcgccggcgtcggcatcgacgtgcacaccgcgatc
gtcgcgacgatcggcctggacgtcgtcgacgcgttctacatccaggaggccgacggcgcc
gaggtggtcggcgaggcccgccgccgcgaggtcagcgaggccgtcgccgcggccctcatg
acctccgacaccccggcgccggaggcctag

DBGET integrated database retrieval system