KEGG   Frankia symbiont: FsymDg_2037Help
Entry
FsymDg_2037       CDS       T01530                                 

Definition
(GenBank) Acetaldehyde dehydrogenase
  KO
K04073  acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
fsy  Frankia symbiont
Pathway
fsy00360  Phenylalanine metabolism
fsy00362  Benzoate degradation
fsy00620  Pyruvate metabolism
fsy00621  Dioxin degradation
fsy00622  Xylene degradation
fsy00650  Butanoate metabolism
fsy01100  Metabolic pathways
fsy01120  Microbial metabolism in diverse environments
fsy01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:fsy00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    FsymDg_2037
   00650 Butanoate metabolism
    FsymDg_2037
  Amino acid metabolism
   00360 Phenylalanine metabolism
    FsymDg_2037
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    FsymDg_2037
   00622 Xylene degradation
    FsymDg_2037
   00621 Dioxin degradation
    FsymDg_2037
Enzymes [BR:fsy01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     FsymDg_2037
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetDehyd-dimer Semialdhyde_dh GFO_IDH_MocA DapB_N CoA_binding
Motif
Other DBs
NCBI-ProteinID: AEH09462
JGI: FsymDg_2037
UniProt: F8AXH5
Position
2420817..2421833
Genome map
AA seq 338 aa AA seqDB search
MSTTKVAVIGSGNIGTDLMIKIMRLSSTLEIAAMVGIDPASDGLARAARLKVPTTANGVQ
GLIDLPGFDEIGVVFDATSAKAHVANARALAGYGKRLVDLTPAAIGPYVVPAVNLSQHLD
APNVNMVTCGGQATIPMIAAVSRVTRVRYGEIVASIASKSAGPGTRANIDEFTETTARAI
EVVGGADVGKAIIVLNPAEPPMIMRDTVLCLADDADPDDIRASIAAMAAEVARYVPGYRL
KQQVQIAPVDPDEPLRTLIGDAGPRPAWKVSVFLEVEGAAHYLPAYAGNLDIMTSAALQT
AERLSAAGSPAIAWPAPVGEPAASPAVSAVPVSSEVAL
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccaccaaggtcgcggtcatcggctcggggaacatcggcaccgatctgatgatc
aaaatcatgcggctctcgtccacgctggagatagcggccatggtgggcatcgatcccgcc
tccgacgggctggcccgcgcggcccgcctgaaggtgccgaccacggcgaacggggtccag
ggcctgatcgacctgccgggcttcgacgagatcggcgtcgtgttcgacgcgacgtcggcc
aaggctcacgtggcgaacgcgcgtgcgctggccgggtacggcaagcggctggtggacctg
acccccgccgctatcgggccgtacgtcgtcccggcggtcaacctctcccagcacctcgac
gcgcccaacgtgaacatggtgacctgcggcgggcaggccaccatcccgatgatcgccgcg
gtgtcccgggtgacccgtgtccgctacggggagatcgtggcgtcgatcgcctcgaagtcg
gccggcccgggcacccgcgcgaacatcgacgagttcaccgagaccaccgcgcgcgccatc
gaggtcgtcggcggcgcggacgtcgggaaagcaatcatcgtcctcaacccggccgaaccg
ccgatgatcatgcgtgacaccgtgctgtgcctggcggacgacgccgaccccgacgacatc
cgcgccagcatcgccgcgatggccgcggaggtggcccgttacgtgcccggataccggctc
aagcagcaggtccagatcgcccctgtcgacccggacgagccgctgcgaaccctgatcggc
gacgccggcccgcggccggcctggaaggtgtcggtcttcctggaggtcgagggagccgcc
cactacctgccggcatacgccgggaacctcgacatcatgacctcggccgcgctacaaacc
gctgaacgactgtccgccgcggggtcaccggccatcgcgtggcccgcgccggtgggggag
ccggcagcgtcaccggcggtgtcagccgttccagtcagctcggaggtggccctgtga

DBGET integrated database retrieval system