KEGG   Frankia symbiont: FsymDg_2037Help
Entry
FsymDg_2037       CDS       T01530                                 

Definition
acetaldehyde dehydrogenase (EC:1.2.1.10)
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
fsy  Frankia symbiont
Pathway
Phenylalanine metabolism
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:fsy00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    FsymDg_2037
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    FsymDg_2037
   00650 Butanoate metabolism
    FsymDg_2037
  Amino acid metabolism
   00360 Phenylalanine metabolism
    FsymDg_2037
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    FsymDg_2037
   00622 Xylene degradation
    FsymDg_2037
   00621 Dioxin degradation
    FsymDg_2037
Enzymes [BR:fsy01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     FsymDg_2037
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2420817..2421833
Genome map
AA seq 338 aa AA seqDB search
MSTTKVAVIGSGNIGTDLMIKIMRLSSTLEIAAMVGIDPASDGLARAARLKVPTTANGVQ
GLIDLPGFDEIGVVFDATSAKAHVANARALAGYGKRLVDLTPAAIGPYVVPAVNLSQHLD
APNVNMVTCGGQATIPMIAAVSRVTRVRYGEIVASIASKSAGPGTRANIDEFTETTARAI
EVVGGADVGKAIIVLNPAEPPMIMRDTVLCLADDADPDDIRASIAAMAAEVARYVPGYRL
KQQVQIAPVDPDEPLRTLIGDAGPRPAWKVSVFLEVEGAAHYLPAYAGNLDIMTSAALQT
AERLSAAGSPAIAWPAPVGEPAASPAVSAVPVSSEVAL
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccaccaaggtcgcggtcatcggctcggggaacatcggcaccgatctgatgatc
aaaatcatgcggctctcgtccacgctggagatagcggccatggtgggcatcgatcccgcc
tccgacgggctggcccgcgcggcccgcctgaaggtgccgaccacggcgaacggggtccag
ggcctgatcgacctgccgggcttcgacgagatcggcgtcgtgttcgacgcgacgtcggcc
aaggctcacgtggcgaacgcgcgtgcgctggccgggtacggcaagcggctggtggacctg
acccccgccgctatcgggccgtacgtcgtcccggcggtcaacctctcccagcacctcgac
gcgcccaacgtgaacatggtgacctgcggcgggcaggccaccatcccgatgatcgccgcg
gtgtcccgggtgacccgtgtccgctacggggagatcgtggcgtcgatcgcctcgaagtcg
gccggcccgggcacccgcgcgaacatcgacgagttcaccgagaccaccgcgcgcgccatc
gaggtcgtcggcggcgcggacgtcgggaaagcaatcatcgtcctcaacccggccgaaccg
ccgatgatcatgcgtgacaccgtgctgtgcctggcggacgacgccgaccccgacgacatc
cgcgccagcatcgccgcgatggccgcggaggtggcccgttacgtgcccggataccggctc
aagcagcaggtccagatcgcccctgtcgacccggacgagccgctgcgaaccctgatcggc
gacgccggcccgcggccggcctggaaggtgtcggtcttcctggaggtcgagggagccgcc
cactacctgccggcatacgccgggaacctcgacatcatgacctcggccgcgctacaaacc
gctgaacgactgtccgccgcggggtcaccggccatcgcgtggcccgcgccggtgggggag
ccggcagcgtcaccggcggtgtcagccgttccagtcagctcggaggtggccctgtga

DBGET integrated database retrieval system