KEGG   Francisella tularensis subsp. tularensis FSC198: FTF0632cHelp
Entry
FTF0632c          CDS       T00381                                 

Definition
hypothetical protein
Orthology
K00493  
unspecific monooxygenase [EC:1.14.14.1]
Organism
ftf  Francisella tularensis subsp. tularensis FSC198
Pathway
Fatty acid degradation
Tryptophan metabolism
Aminobenzoate degradation
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ftf00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    FTF0632c
  Amino acid metabolism
   00380 Tryptophan metabolism
    FTF0632c
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    FTF0632c
Enzymes [BR:ftf01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     FTF0632c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(651561..652751)
Genome map
AA seq 396 aa AA seqDB search
MEVKNEKIAINGTGISGLTLAWWLRKYGFEPTLFEKASELRNGGYLVDFWGPACEIMKKM
GLFDQLKEKSYQIKNIHCFDENGRRSSKVNISSLITDNYDEFLSVKRGDIAETIYKACQG
IDIRFATSIDKIEEKDNHITTHLSDGTKEDFDLVIGADGLHSHIRSLVFDKSEYQEYELD
KYVAALSLKNYNHYEKYTYAISVGDKKQVARVCLDENETLVMFIIDLSLVNNFPLTLAEK
KQLLVSSFKEFKWETPDILARLTDVDEIYFDKVSQIRMDTWYKGRIALVGDSAACPSVLM
GLGSIFAIIEAYILAGELHKAKGNYHIAFEQWQNRLKDIIARKQKVGLSNLSVAASDEIF
KKYLSTITVKISSTPVISKFIGAGIFNDPIQIPEYE
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggaagtaaaaaatgaaaaaattgcaatcaatggtacaggaatatcgggcttaacttta
gcgtggtggttaagaaagtatggttttgagccaacacttttcgaaaaagcttcggagctt
agaaatggtggttatcttgttgatttttggggtcctgcttgtgaaataatgaaaaaaatg
gggctttttgatcagctaaaagaaaaatcatatcaaatcaaaaatattcactgttttgat
gaaaatggcagaagatcatcgaaggttaatatttcttctttaatcactgataattatgac
gaattcctaagtgtcaaacgaggagatatagctgagacaatatataaggcttgtcaaggc
atagatattagatttgccacatcgatagacaagatagaagaaaaagacaaccatattacc
actcatcttagtgatggtacaaaagaagactttgatttagtcataggagctgatggttta
cactcacatattcgtagtttagtatttgataaatcagaatatcaagaatatgaattagat
aagtatgtagctgcgctttctcttaaaaactacaatcattatgaaaaatatacttatgca
attagtgtaggtgataaaaaacaagttgctagagtttgcttagatgaaaatgagacactt
gtaatgtttataatagatttgtcacttgttaataattttccattaacgctagcagagaaa
aaacaattactggttagttcattcaaagaatttaaatgggagactcctgatatcttagca
agactaacagatgttgatgaaatatactttgataaagtaagccagataagaatggatact
tggtacaaaggaagaatcgcattagttggcgattcggcagcttgtccttcagtactaatg
ggactaggtagtatatttgcaattattgaggcttatatcttagcaggtgaattacataag
gcaaaaggcaattatcatatagctttcgagcaatggcaaaatagactaaaagatataata
gctagaaaacaaaaagtaggtctatcaaatctatctgtagctgcttctgatgaaatattc
aaaaaatacttatcaactatcactgttaagatatcttcgactcctgttatttctaaattt
atcggtgctgggatatttaatgatccaattcaaattccagagtatgaataa

DBGET integrated database retrieval system