KEGG   Francisella tularensis subsp. tularensis FSC 198: FTF0632cHelp
Entry
FTF0632c          CDS       T00381                                 

Definition
hypothetical protein
Orthology
K00493  
unspecific monooxygenase [EC:1.14.14.1]
Organism
ftf  Francisella tularensis subsp. tularensis FSC 198
Pathway
Fatty acid degradation
Tryptophan metabolism
Aminobenzoate degradation
Microbial metabolism in diverse environments
Class
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:ftf00071]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:ftf00380]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:ftf00627]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(651561..652751)
Genome map
AA seq 396 aa AA seqDB search
MEVKNEKIAINGTGISGLTLAWWLRKYGFEPTLFEKASELRNGGYLVDFWGPACEIMKKM
GLFDQLKEKSYQIKNIHCFDENGRRSSKVNISSLITDNYDEFLSVKRGDIAETIYKACQG
IDIRFATSIDKIEEKDNHITTHLSDGTKEDFDLVIGADGLHSHIRSLVFDKSEYQEYELD
KYVAALSLKNYNHYEKYTYAISVGDKKQVARVCLDENETLVMFIIDLSLVNNFPLTLAEK
KQLLVSSFKEFKWETPDILARLTDVDEIYFDKVSQIRMDTWYKGRIALVGDSAACPSVLM
GLGSIFAIIEAYILAGELHKAKGNYHIAFEQWQNRLKDIIARKQKVGLSNLSVAASDEIF
KKYLSTITVKISSTPVISKFIGAGIFNDPIQIPEYE
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggaagtaaaaaatgaaaaaattgcaatcaatggtacaggaatatcgggcttaacttta
gcgtggtggttaagaaagtatggttttgagccaacacttttcgaaaaagcttcggagctt
agaaatggtggttatcttgttgatttttggggtcctgcttgtgaaataatgaaaaaaatg
gggctttttgatcagctaaaagaaaaatcatatcaaatcaaaaatattcactgttttgat
gaaaatggcagaagatcatcgaaggttaatatttcttctttaatcactgataattatgac
gaattcctaagtgtcaaacgaggagatatagctgagacaatatataaggcttgtcaaggc
atagatattagatttgccacatcgatagacaagatagaagaaaaagacaaccatattacc
actcatcttagtgatggtacaaaagaagactttgatttagtcataggagctgatggttta
cactcacatattcgtagtttagtatttgataaatcagaatatcaagaatatgaattagat
aagtatgtagctgcgctttctcttaaaaactacaatcattatgaaaaatatacttatgca
attagtgtaggtgataaaaaacaagttgctagagtttgcttagatgaaaatgagacactt
gtaatgtttataatagatttgtcacttgttaataattttccattaacgctagcagagaaa
aaacaattactggttagttcattcaaagaatttaaatgggagactcctgatatcttagca
agactaacagatgttgatgaaatatactttgataaagtaagccagataagaatggatact
tggtacaaaggaagaatcgcattagttggcgattcggcagcttgtccttcagtactaatg
ggactaggtagtatatttgcaattattgaggcttatatcttagcaggtgaattacataag
gcaaaaggcaattatcatatagctttcgagcaatggcaaaatagactaaaagatataata
gctagaaaacaaaaagtaggtctatcaaatctatctgtagctgcttctgatgaaatattc
aaaaaatacttatcaactatcactgttaagatatcttcgactcctgttatttctaaattt
atcggtgctgggatatttaatgatccaattcaaattccagagtatgaataa

DBGET integrated database retrieval system